KEGG   Natrinema sp. J7-2: NJ7G_4169Help
Entry
NJ7G_4169         CDS       T02184                                 

Definition
PfkB domain protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nat  Natrinema sp. J7-2
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nat00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    NJ7G_4169
Enzymes [BR:nat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     NJ7G_4169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3601643..3602527)
Genome map
AA seq 294 aa AA seqDB search
MDSVTVLAAGHVNWDVTLRVDRFPEPDGEASIRSQRQSGGGSAANVAAALAGLDVETGLI
GSVGDDDHGLLARRELEAAGVSLSGVRVVEGAETAVKYLLVDETGEVAILGNDGVNEAVT
PDDIEPDRVRSADHVHLTGQRPDTAAAIARIASDAGRSVSFDPGRRLGDREYGEALALAD
VVFVTDREAMVLFGDDWTDAADERIIVVTCGADGAEAYTPDRTVVHAGFDVDPVDTAGAG
DAFAAGFLATWLEDRNIDRALAYGNACGALTAGCDGARSAPTAAAVEDVLTERS
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggattcggttacggtactcgccgccggacacgtcaactgggatgtgaccctccgggtc
gacaggttccccgaacccgacggcgaggcgtcgatccgctcgcaacgccagtccggcggc
ggcagcgccgccaacgtcgccgccgcactcgccggcctcgatgtcgagaccggactgatc
gggagcgtcggcgacgacgatcacggcttgcttgcccgccgtgaactcgaggccgcgggc
gtctcgctgtccggcgtgcgcgtggtcgagggggccgaaacggcggtcaagtacctcctc
gtcgacgagacgggggaggtcgcgatactcggcaacgacggggtcaacgaggcagtcacg
cccgacgacatcgagcctgaccgagttcggtcggccgatcacgtacacctcacggggcaa
cggccggacaccgccgctgcgatcgcccggatcgcaagcgacgcggggcgttccgtcagt
ttcgatcccggccgccggctcggggaccgggagtacggcgaggcgctcgcgctcgcggat
gtcgtcttcgtgaccgatcgggaagctatggtgctgttcggggatgactggaccgacgcg
gccgacgagcgcatcatcgtcgtcacctgcggagccgacggggccgaagcgtacacaccg
gaccgtaccgtcgttcacgcggggttcgatgtcgatcccgtcgataccgccggcgcgggc
gacgcttttgccgccggctttctcgcgacgtggctcgaggacagaaatatcgaccgcgcg
ctcgcgtacgggaacgcctgtggggcgctgactgcgggctgcgacggcgcgcggagcgcg
ccgacggccgcggccgtcgaggacgttctcacggagcggtcgtaa

DBGET integrated database retrieval system