KEGG   'Nostoc azollae' 0708: Aazo_0100Help
Entry
Aazo_0100         CDS       T01260                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01130  Biosynthesis of antibiotics
naz01230  Biosynthesis of amino acids
Module
naz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aazo_0100
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Aazo_0100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADI62749
JGI: Aazo_0100
UniProt: D7DVK2
Position
89809..90693
Genome map
AA seq 294 aa AA seqDB search
MKIRRRSPSPTIDVSVIRYQAVLQDAAPNNILEEIVWQKEIEIEQMREKLPLRELQKKVL
SAPPTRDFVAALRQGKTKPALIAEVKKASPSKGILRADFDPVAIAQSYQEGGASCLSVLT
DRKFFQGSFENLCLVHAAVDLPVLCKEFIIYPYQIYLARINGADAILLIAGILSAQDLQY
FVKIANNLKMAALIEVHSLEQLDRVLSLDGVTLVGINNRNLEDFSVDLQTTCQLLKDKGS
QLQARNILVVSESGIHTPEDLSVVETAGASAVLIGESLVKQPDPKLAITNLFGK
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccgtcgtcgttcacctagtcccactattgatgtctctgttatccgctaccaa
gcagttttacaagatgcagcgccaaataatattttggaagaaattgtttggcaaaaagag
atagaaattgagcaaatgcgggaaaagctgcctttgcgagaattgcagaaaaaggtgctt
tccgcacctcctacccgtgattttgttgccgcactccgtcaaggtaaaaccaaacccgca
ctaattgctgaagtgaaaaaagcctctcctagcaagggaattttacgcgcagattttgac
ccagtagcgatcgcacaatcttatcaagaaggtggtgctagttgtctttctgtactcaca
gataggaagttttttcaaggtagttttgagaacttatgtttagttcatgctgcggtagat
ttgccagtattatgtaaggaatttatcatttatccttatcaaatttatttagcgcgaatt
aatggcgcagatgcgattttattaattgcgggaattctcagcgctcaagatttacaatat
tttgtcaaaattgccaataatctaaaaatggcagctttgatagaagttcatagtttagaa
caacttgacagagttttatccttagatggtgttaccttagttggtatcaataatcggaac
ctagaagatttttctgttgatttgcaaactacttgtcagttactaaaagataaaggcagt
caattacaggccagaaatattttggtagttagtgaatcaggaattcataccccagaggat
ttaagtgtagtggaaacagccggcgcatcagccgtactcattggtgagtcattggtcaaa
caaccagatccaaaactggcaattactaatctttttggtaaatag

DBGET integrated database retrieval system