KEGG   Anabaena azollae 0708: Aazo_0542Help
Entry
Aazo_0542         CDS       T01260                                 

Definition
magnesium chelatase subunit H (EC:6.6.1.1)
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
naz  Anabaena azollae 0708
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aazo_0542
Enzymes [BR:naz01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Aazo_0542
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
562235..566224
Genome map
AA seq 1329 aa AA seqDB search
MFTQVKSTIRHIAPNDLRGRNLIKVVYVVLESQYQSALSQAVREVNANHPNVAIEISGYL
IEELRKAENYEQFQRDIASANIFIASLIFIEDLAQKVVAAVEPHRDNLDVSVVFPSMPEV
MRLNKMGTFSLAQLGQSKSAIAQFMKKRKEKSGASFQDGMLKLLRTLPQVLKFLPIDKAQ
DARNFMLSFQYWLGGSAENLENFLLMLADKYVLKSSKEQRTEESINYAAPVLYPDMGIWH
PLATTMFEDVREYLNWYTGRKDISKDVKDPLAPCIGLVLQRTHLVTGDDAHYVAIVQEFE
SLGAKVLPVFAGGLDFSKPIEAYFYEPTTSRQLVDAVVSLTGFALVGGPARQDHPKAIDA
LKRLNRPYMVALPLVFQTTEEWLDSELGLHPIQVALQIAIPELDGAIEPIILSGRDGATG
KAIALQDRVESVAQRALKWANLRRKPKLDKKVAITVFSFPPDKGNVGTAAYLDVFGSIHE
VMKGLRNNGYDVQDIPETAKELMEQVIHDAQAQYASPELNIAYKMSVPEYEALTPYSQRL
EENWGPPPGNLNSDGQNLLIYGKQFGNVFIGVQPTFGYEGDPMRLLFSRSASPHHGFAAY
YTYLERIWSADAVLHFGTHGSLEFMPGKQMGMSGDCYPDQLIGTIPNLYYYAANNPSEAT
IAKRRSYAETISYLTPPAENAGLYKGLKELSELIASYQTLKDSGRGVPIVNSIMDKCRIV
NLDKDINLPETDAKDMSSEERDNIVGMVYSKLMEIESRLLPCGLHVIGKPPTAEEAVATL
VNIASLDRSEEEIFSLPRIIANSLGRDIDEIYKNSDAGILADVQLLQDITLATRAAVGSL
VQEQTDAEGRVSLVSKLNFFKMGKKEPWVESLHKSGYSKVDTSALKPLFEYLEFCLKQVC
ADNELGGLLQGLEGEYILPGPGGDPIRNPDVLPTGKNIHALDPQSIPTTAAVQSAKTVVD
RLLERNKAENGGNWPETVACVLWGTDNIKTYGESLAQIMWMVGVRPVADALGRVNKLELI
PLEELGRPRIDVVINCSGVFRDLFINQMNLLDQGVKMAAEADEPLEMNFVRKHALQQAEE
MGINLRQAATRVFSNASGSYSSNINLAVENSTWDSEAELQEMYLKRKSFSFNSDNPGVMD
ESRQIFETTLKTADATFQNLDSSEISLTDVSHYFDSDPTNLVASLRADGKKPTSYIADTT
TANAQVRSLSETVRLDARTKLLNPKWYEGMLSHGYEGVRELSKRLVNTTGWSATAGAVDN
WVYEETNETFIKDEEMQKRLMNLNPHSFRKIVSTLLEVNGRGYWETSEENLDQLRELYQE
VENRIEGIE
NT seq 3990 nt NT seq  +upstreamnt  +downstreamnt
atgtttacccaggtcaagtccactattagacatattgcacctaatgatttacggggacgt
aatctgattaaggttgtttatgttgtgcttgagtctcaataccaaagtgctttatcacaa
gcagtaagagaggttaatgctaatcatcccaatgtggcgattgaaatcagtgggtattta
attgaagaactacgcaaggcagagaattatgaacagtttcagcgtgacatagctagtgct
aatatattcattgcctcactaattttcatcgaagacttagcccagaaagtcgttgcggct
gttgaaccccatcgggataacctggatgtttccgttgttttcccatctatgccagaggta
atgcgccttaataagatgggtactttttccctagcacaattaggacaatccaagagtgca
atcgctcaattcatgaaaaagcgcaaggaaaaatctggcgctagctttcaggatgggatg
ttgaaactactgagaacgctgccccaggtgctaaaattcctacccatagataaagcccag
gatgcacgtaatttcatgcttagtttccagtattggttaggtggttcagccgagaatctg
gaaaacttcctgttaatgctggcagataaatatgtattaaaaagcagcaaagaacaaaga
acagaagaaagtattaactatgctgcacctgttctttatcctgacatgggaatttggcac
cctttagctactacaatgtttgaagatgtacgtgaatacctcaactggtacaccggccgt
aaggatatttccaaagatgtaaaagacccacttgctccatgtattggactagttttacaa
agaactcacttagtaactggtgatgatgcccactatgtagcgattgtgcaagaatttgaa
tcattaggggcaaaagtattacctgtgtttgctggcggtttagatttctcgaagccaata
gaagcttacttctatgaacctacaaccagtagacaactagtagatgcagtagtatcctta
acaggatttgctttagtcggtgggcctgcaagacaagaccatcccaaagctatagacgca
cttaaacgcctcaatcgtccctacatggtggccttacccctcgttttccaaactaccgaa
gaatggttagacagcgaactaggcttacaccccattcaagtagccttacaaattgccatt
cccgaacttgacggtgcgatcgaacccatcatattatcaggtagagatggagccacagga
aaagcgatcgcactccaagaccgagtagagtcagtagcccaacgtgccttaaaatgggca
aacctacgccgcaaacccaaactagacaagaaagttgccatcaccgttttcagctttcca
ccagataaaggcaacgtcggaacagccgcatatttagacgtattcggttcaatccacgaa
gtcatgaaaggactgagaaacaacggttacgacgtacaggacattcccgaaactgcaaaa
gagttgatggaacaagtcatccacgacgcacaagcacaatacgcaagccccgaactcaac
atcgcttacaaaatgtccgtgccagaatatgaagcactaacaccatactcccaacgctta
gaagaaaactggggaccaccaccaggaaacttaaacagcgacggacaaaacctactcatc
tacggtaaacaattcggtaacgtcttcatcggtgtgcaacccacctttggttatgaaggc
gaccccatgcgcttattattctcacgctccgctagtcctcaccacggttttgccgcttac
tacacctacctagaacggatttggagtgctgatgctgttttacactttggtacacatggc
tcattggaattcatgcctggtaagcaaatgggaatgtctggtgattgttaccccgatcaa
ctaattggcacaattccaaacctgtattattacgcagctaataaccccagtgaagccacc
attgccaaacgtcggagttacgcagaaacaatttcttacctcacacctcctgcagaaaat
gcaggtttgtacaaaggtttgaaagaactcagtgaattaattgcatcttaccaaacctta
aaagatagcggtcgtggagttcccattgttaactccatcatggataaatgtcgtatcgtt
aacctagacaaagatattaacttacccgaaaccgacgcaaaagatatgtcctcagaagaa
agggataatatcgtcggtatggtttatagcaagttaatggaaattgaatctcggttatta
ccttgcggtttgcacgtcattggtaaaccacccacagcagaagaagccgttgcaacttta
gtcaatattgccagcttagaccgcagcgaagaagaaattttcagtttaccccgaattatt
gccaacagcttaggacgggacattgacgaaatatacaaaaacagcgatgccggcatttta
gccgacgtgcaactattacaagatatcaccctcgcaactcgcgctgctgtcggttcctta
gtacaagaacaaaccgacgcagaaggtagagtttccctagtttccaagttgaacttcttc
aaaatgggcaaaaaagaaccttgggtagaatcattgcacaaatctggttacagcaaagtt
gacacctctgcattaaaaccattattcgagtatttggaattctgcttaaaacaagtttgt
gcagataacgaacttggtggtttactgcaaggtttagaaggtgaatatattttaccagga
cccggtggcgaccccatccgcaaccctgacgtattgcctacaggtaaaaatatacacgcc
ttagatccccaatctatccccaccaccgccgcagttcaatcagctaaaaccgttgttgat
aggcttttagaacgtaacaaggctgaaaatggtggaaactggccagaaactgtcgcttgc
gtcctctggggtacagataacatcaaaacctacggtgaatcactcgcccaaattatgtgg
atggtgggagtgcgcccagttgccgatgctttgggacgggtaaacaagttagaattaata
cctttggaagaattgggacgacctagaattgacgttgtaattaactgttctggtgtgttc
cgcgacttgttcattaaccaaatgaacctacttgaccaaggtgtgaaaatggcagcagaa
gctgatgaacccttggaaatgaattttgtccgtaaacacgctttgcaacaagcagaggaa
atggggataaatctgcgtcaagctgcaactcgcgttttctctaatgcttctggttcttat
tcttctaatataaaccttgcggtggagaatagcacttgggatagtgaagcagagttgcaa
gaaatgtatttgaagcgcaaatctttctcttttaattctgataatcctggtgttatggat
gagtcacggcagatttttgaaactactttgaaaactgctgatgcaactttccaaaacctt
gattcttcggaaatcagtttaacagatgtttcccattatttcgactctgacccaactaac
ttagttgcaagtctgcgtgcagatggtaagaaacctacatcttacattgcagatacaact
accgcgaatgcacaggtaagaagtttatcagaaactgtgcgtttggatgcgcggaccaag
ttgttaaaccccaaatggtatgaggggatgttgtctcacggttacgaaggtgtgcgggaa
ctttctaagcgattggtaaatactactggttggagtgcgactgctggtgctgtggataat
tgggtttatgaggaaaccaatgagacatttattaaagatgaggaaatgcagaagcgtttg
atgaatcttaatcctcattctttccgcaagattgtttctactttgttggaagtcaatggt
cgcggttattgggagactagtgaggagaatttggatcagttgagagagttgtatcaggag
gtggaaaaccggattgagggtatagaatag

DBGET integrated database retrieval system