KEGG   'Nostoc azollae' 0708: Aazo_0646Help
Entry
Aazo_0646         CDS       T01260                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00900  Terpenoid backbone biosynthesis
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01130  Biosynthesis of antibiotics
Module
naz_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Aazo_0646
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Aazo_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C B12-binding
Motif
Other DBs
NCBI-ProteinID: ADI63116
JGI: Aazo_0646
UniProt: D7E0Y7
Position
complement(675972..677168)
Genome map
AA seq 398 aa AA seqDB search
MKAITLLGSTGSIGTQTLDIVSEHPDKFRIVGLAAGRNVELFAAQIRQFRPQIVAISAAD
KLPELREAIKHVNPQPILLAGEEGVIEVARYGDVETVVTGIVGCAGLLPTIAAIEAGKDI
ALANKETLIAGAPVVLPLVEKYGVKLLPADSEHSAIFQCLQGVPKGGLRKILLTASGGAF
RDWPVEKLPEVKVADALKHPNWSMGRKITVDSATLMNKGLEVIEAHYLFGVDYDDIEIVI
HPQSIIHSLIELQDTSILAQLGWPDMRLPLLYALSWPERVYTNWERLNLVKSGDLTFHEP
DHQKYPCMGLAYAAGRAGGSMPGVLNAANEQAVALFLEEKISYLDIARCIELVCDHHQRD
NTRNPSLSDILAADQWARQEVFTATEKLVIQPQIISLG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctattactcttcttggttctaccggctctattggtactcagactttagacatc
gtttctgagcatccagataagtttcgtatagttggactggctgctgggcggaatgtggag
ttgttcgcggcgcaaattcgccagtttcgtccccaaattgtggctatttctgctgctgat
aagttaccagaacttcgggaagcaattaagcatgtcaacccccaacctattttactggct
ggtgaagagggtgtgatagaagtggctcgttatggtgatgttgaaacggttgttactggt
attgttggttgtgcgggtttacttcccactatcgctgctattgaagcaggtaaggatatt
gctttagcaaacaaagaaactctcattgctggcgctcctgtggttttacctctggtggaa
aaatatggtgtgaaactattaccagcagattctgaacattcggcgatttttcaatgtctc
caaggtgttcctaaaggtggtttaaggaagatattacttactgcttctggtggtgctttc
cgtgattggcctgtggaaaagttgcctgaagtaaaagttgctgatgctctgaaacatcct
aattggtccatgggacgaaaaatcactgttgattcagcaactttgatgaataagggtttg
gaagttattgaggctcattatctgtttggggtggattatgatgatattgaaattgttatt
catcctcaaagtattattcattctttgattgagttacaagacacttctattttagctcaa
cttggttggccagatatgcgtttacctttgctttatgctttatcttggccggagcgagtt
tacactaactgggaaagattgaacttggttaaatctggtgatttaactttccatgaaccg
gatcatcaaaaatatccttgtatgggattggcttatgctgcgggtagggctggcggttct
atgcctggagttttaaatgctgctaatgagcaagctgtggcgctatttctagaagagaaa
attagctatttggatattgctcggtgtattgaattggtgtgcgatcaccatcaacgtgat
aacacacgtaatccttctttaagtgacattttggcagcagatcaatgggctagacaagag
gttttcacggctacagaaaaattagtaattcagccacagataatttctctaggctaa

DBGET integrated database retrieval system