KEGG   Anabaena azollae 0708: Aazo_0722Help
Entry
Aazo_0722         CDS       T01260                                 

Definition
glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
naz  Anabaena azollae 0708
Pathway
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Aazo_0722
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Aazo_0722
Enzymes [BR:naz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Aazo_0722
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
757362..759782
Genome map
AA seq 806 aa AA seqDB search
MTTSPFPEIPSCSWQRPIGLGWDKPYTVRYVSNIDDGPWHGMPLGGFGAGCIGRSSRGDF
NLWHIDGGEHLFKSFPSCQFSVFESTGSSSKAYALSTEIPEDGTLQSWQWYPPSTTTQAT
GTYHALYPRSWFVYENVLQTQLTCEQFSPIWANNYQETSYPVAVFVWKAHNPTNAPITLS
IMLTWENIVGWFTNALKSPDLQIRDDGSPVYEYQPRLGESKGNYNHIVENTEFFGCFLGR
VPTGLPIQEGDGSWCIATPKNPRMEVFYHTHFNPVGSGADLWESFSTDGYLPNYLNATPA
DADTRLGAALAVRCTLQPGETLEIPFTLAWDFPVTEFAEGINYYRRYTDFFSRYGDNAFA
ITSRGLEQYQVWRAQIQNWQKPILDREDLPEWFKMALFNELYDLTSGGTLWSAASEIDPI
GQFAVLECLDYRWYESLDVRLYGSFALLILFPELEKSVIRAFARAIPHSDDHLRVIGYYY
TIGAETKKAIRKVAKATPHDLGAPNEWVWEKTNYTCYQDCNLWKDLSSDFVLQVYRDFLF
TGSHDVQFLVDCWDAIVQTLDYLKTFDLDGDGIPENSGAPDQTFDDWLLNGVSAYCGGLW
LAALESAIAIADILTNHRGTENTEKTDKLRSQKSIYQSWLQQSRPIYEQKLWNGQYYRLD
SESGSDVVMADQLCGQFYTRLLGLPDIVPSNHAHSALQTVYEACFVKFYDGKFGAANGVL
PDGSPENPKATHPLEVWTGINFGLAAFLVQMGMKNEAMQLTQAVVEQIYDNGLQFRTPEA
ITPVGTFRASTYLRPMAIWAIYMMFI
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atgacaacttcccccttcccagaaattccctcctgtagttggcagcgtcccatcgggtta
ggttgggacaagccttatactgtccgctatgtgagtaatatagatgatggaccatggcac
ggaatgcctttggggggttttggtgctggttgtattggccgttcttcacgaggagacttt
aatctgtggcacattgacggtggtgaacatctcttcaaatcctttccatcttgccaattt
agtgtatttgaatctactggttcatcttctaaagcttatgcattatcgaccgaaatcccg
gaagatgggactctacaaagttggcaatggtatccaccatcaactactacccaagcaacc
ggcacctatcatgcactttatcctcgcagctggtttgtttatgaaaatgtcttgcaaacc
cagctaacttgtgagcagttttcccctatttgggcaaataattatcaagaaactagttat
cctgtagctgtttttgtttggaaagcacataaccccacaaatgcacctattaccctcagt
atcatgctgacttgggaaaacatagtgggttggtttactaatgctctgaaatctcctgat
ttgcagatacgggatgatgggagtccggtttatgaatatcagccgcgtttaggtgaaagt
aaaggaaactacaatcatatagtggaaaatacagaattttttggctgttttttgggtcgt
gtgcctactggtttacctatacaggaaggtgatggtagctggtgtattgctactcctaaa
aatccccgcatggaagtattttatcatacgcattttaatccagtcggttcaggtgcggat
ctttgggaaagcttttcaactgatggttatttgcctaattatctgaatgcaactcccgca
gatgcagatacacggttaggggctgccttggctgtgcgttgtactctccaaccaggggaa
actctggaaattccctttactctggcttgggattttcctgtaacggaatttgctgagggc
attaattattaccgtagatatacagatttttttagtcgctatggtgataatgcttttgca
atcacatctagaggactagaacaatatcaagtttggcgagcgcagattcaaaattggcaa
aaaccgattcttgaccgcgaagatttgccagaatggtttaagatggcactctttaacgaa
ctttatgacctcacaagcggtggaactctctggagtgcagcctcagaaattgatcccata
ggtcagtttgctgtcttagaatgtttagattaccgttggtatgaaagtttagatgtcagg
ttatatggttctttcgccctactaatcttattcccagaactcgaaaagtcagtaattcgc
gcctttgcacgggcaattccccacagcgatgatcatctgcgagtgattggctattattat
acaattggtgctgaaacaaaaaaagccatccgcaaagtagctaaagctacaccccatgac
ttaggcgcaccaaatgaatgggtgtgggaaaaaaccaactacacctgttatcaagattgc
aacttatggaaagacttaagtagcgattttgtattgcaagtataccgagattttctattt
acaggtagtcacgatgtacaatttttggtagactgttgggatgcaattgtgcagactctc
gattatttgaaaacctttgatttagatggtgatggaataccagaaaattctggcgcacct
gatcaaacctttgatgattggctgttaaatggtgttagtgcatattgtggcgggttgtgg
ttagcggctttagaaagtgctatcgcaatagctgatattttaacaaaccatagaggcaca
gagaacacagagaagacagacaaattgcgatcgcaaaaatcaatttatcaatcttggtta
caacaatcaagaccaatttatgaacaaaagctttggaacggtcagtattaccgcttagac
agtgaaagtggttctgatgtagtcatggcagaccagttatgtggacaattctacacgcgg
ttactgggtttaccggatattgtccccagtaatcatgcccattctgccttgcaaacagta
tatgaagcctgctttgtaaagttttatgatggtaagtttggtgcagctaacggcgttctt
cccgacggttctccagaaaaccccaaagccacccatcctctagaagtatggactggaatt
aactttggtttagcagctttcctagtgcagatgggtatgaaaaatgaagctatgcagtta
acgcaagccgttgttgagcaaatttacgacaatggtttacaatttcgcacccccgaagcc
attacccccgttggtacttttcgcgctagtacctatctgcgcccaatggctatttgggca
atttatatgatgttcatttaa

DBGET integrated database retrieval system