KEGG   Anabaena azollae 0708: Aazo_0771Help
Entry
Aazo_0771         CDS       T01260                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
naz  Anabaena azollae 0708
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aazo_0771
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_0771
   00052 Galactose metabolism
    Aazo_0771
   00500 Starch and sucrose metabolism
    Aazo_0771
   00520 Amino sugar and nucleotide sugar metabolism
    Aazo_0771
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aazo_0771
   00524 Butirosin and neomycin biosynthesis
    Aazo_0771
Enzymes [BR:naz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Aazo_0771
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(814546..815571)
Genome map
AA seq 341 aa AA seqDB search
MTLVLAGDIGGTKTILRALESSESSGLKTLYEESYCSGDFPDLVLMVQKFLAAANSSTPE
KACFAIAGPVVNNTAKLTNLAWFLDTHRLAQELGIVSISLINDFAAVGYGIFGLTKQDLL
TLQVGKHKPEAPIGVIGAGTGLGQGFLIKQGNQYQVFPSEGGHADFAPRNELEFQLLKYL
LDKHDIERVSAERVISGLGITSIYQFLRDRKIASESPEIAQVVRNLEQEAGQAEKTVDAA
AAIGSAALAKSDCLSEQTIQLFIEAYGAEAGNLALKLLPHGGLYIAGGIAPKILPLMQDG
SFMLNFTHKGRMRSILEEIPVHIILNQQVGLIGAALCASRL
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgacattggtactagcaggagatattggtgggacaaaaactattttgcgagcgcttgaa
tcttctgaatcttcaggattaaaaactttgtatgaggagagttactgcagcggagacttt
cccgatttggtgttgatggtgcagaagtttttggccgcagcaaattcttcgacaccagaa
aaagcttgttttgcgatcgcaggcccggtggtaaacaatactgctaaactgactaattta
gcctggtttttagatacgcacaggttagcccaagaactgggtattgtttctatttccctg
attaatgactttgcggctgttggttatggtatttttggtttaactaaacaagatttactg
actttgcaagttggtaaacataaaccagaagcacctataggggttattggtgcaggaact
ggcttaggacaaggttttttaatcaaacaaggtaatcaatatcaagtttttccctcagaa
ggtggacacgcggattttgcaccccggaatgagttagaatttcaacttttaaaatacctg
ttggataaacatgatattgaacgggtttctgcggaaagagttatttccggcttgggtatt
acttcgatttatcaatttttgcgagatagaaaaatcgctagcgaatcaccagaaattgct
caagttgtcagaaatttggaacaagaagcgggacaagcagaaaaaactgtagatgcagct
gcagctattggtagtgcagctttagcgaaaagtgattgcctttctgaacaaaccatacaa
ctcttcattgaagcttacggtgcagaagctggtaatctggctttgaaattactaccccat
ggtggattatacattgctggtggtatcgctccaaaaattctgcctttgatgcaagatggc
agtttcatgttaaatttcacacacaaagggagaatgcgttctattctcgaagaaattcca
gtccatataattcttaaccaacaagtgggattaattggtgccgctttgtgtgcgtctagg
ctataa

DBGET integrated database retrieval system