KEGG   Anabaena azollae 0708: Aazo_1020Help
Entry
Aazo_1020         CDS       T01260                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
naz  Anabaena azollae 0708
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:naz01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:naz00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1089490..1090815
Genome map
AA seq 441 aa AA seqDB search
MLRIITQQANVRTELQRICERVQRAEGERTQDEQLLHKEATVREVLQAVKRQGDKAVLHY
IAEFDHQTLQPEELRVTGSELDAAYQQVSKDLLAAIQLACRQIEAFHRQRVPKSWVHFGD
DEVVLGKRYTPVDRAGLYVPGGRASYPSTVLMNAIPAKVAGVPRILMVTPARGGKTINSA
VLVAAQEAGIQEIYRIGGAQAIAALAYGTETIPKVNVITGPGNIYVTLAKKLVYGTVGID
SLAGPSEVLIIADQTANPVHVATDLLAQAEHDPMAAAILLTTDAGLAKKVQVAVDRQLVD
HPRRIDTEKAIAHYGLIVVVESLEAAVELSNEFAPEHLELEIKDPWSLISQIRHAGAIFL
GYSTPEAVGDYLAGPNHTLPTSGAARYASGLGVETFLKHSSIIQYSPTALNKVANAIDSL
ATSEGLTSHADSVRRRVQEAE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattattactcagcaggcaaacgttagaaccgaactacaacgtatctgcgaa
cgtgtacaacgcgccgaaggcgaacgcacccaggatgaacaattgcttcataaagaagca
accgtgcgggaagtgttgcaggcagttaaacgccaaggcgataaagctgtactgcactac
atagccgaatttgaccatcaaaccttgcaaccagaagaactacgggtgactggttcagaa
ctggatgcagcttaccaacaggtatcaaaggatttgttagcagctattcagctagcttgt
cgccaaattgaagcgtttcaccgtcagcgagtaccaaaaagctgggtacactttggcgat
gatgaagtagtgctgggtaaacgctatacacctgtagatcgggcaggtttatacgttcct
ggaggtcgcgcttcctatcccagtacagtgttaatgaatgctattccagccaaagtagca
ggtgtacccaggatattgatggtgacaccagcacgaggagggaaaacgattaactcagcg
gttctagtagctgcacaagaagctgggatacaagaaatttaccgcattgggggcgctcaa
gcgatcgcagctttagcttacggtacagaaactatcccgaaagtgaacgtgattactgga
ccaggtaacatttatgtcactttggccaaaaagctagtctatggaacagtgggtattgat
tctttggcaggtcctagcgaagtgctaattattgccgatcaaacagccaatcccgttcat
gtagccacggacttattagcgcaagccgaacatgatccaatggctgcggcgattttgtta
accacagatgctggtttggcaaaaaaagtccaagtggctgtagatagacaactggtggat
cacccacgacggatagatacagaaaaagcgatcgcccattatggcttaattgtggtagtt
gaatccctagaagcagcagtagaactctccaatgagtttgcacctgaacatctagagtta
gaaattaaagatccttggtctttaatttctcaaatccgccatgctggagccattttcctg
ggttactcaacaccagaagcggtgggagactatttagccggacccaaccacaccttgccg
acttctggtgcggctcgttatgcttctggattaggcgtggaaactttcctcaaacattct
agtattatccaatactcaccaactgcactgaacaaagtagctaatgctattgactcttta
gctacatctgaaggtttaacttcccatgctgattcagtcagaaggcgagttcaggaggca
gagtaa

DBGET integrated database retrieval system