KEGG   'Nostoc azollae' 0708: Aazo_1078Help
Entry
Aazo_1078         CDS       T01260                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00010  Glycolysis / Gluconeogenesis
naz00051  Fructose and mannose metabolism
naz00562  Inositol phosphate metabolism
naz00710  Carbon fixation in photosynthetic organisms
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
naz01230  Biosynthesis of amino acids
Module
naz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_1078
   00051 Fructose and mannose metabolism
    Aazo_1078
   00562 Inositol phosphate metabolism
    Aazo_1078
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_1078
Enzymes [BR:naz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aazo_1078
Exosome [BR:naz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aazo_1078
  Exosomal proteins of bladder cancer cells
   Aazo_1078
  Exosomal proteins of melanoma cells
   Aazo_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI63434
JGI: Aazo_1078
UniProt: D7E2Q7
Position
complement(1154528..1155424)
Genome map
AA seq 298 aa AA seqDB search
MIATQLRFCPFFFVSLYLERETKALSPASISRNVQKSSTVKNASCSVSMLTKSPVRKIVI
AGNWKMFKTWSESETFLRGFLPHLEETPSEREIVLCPPFTDLSVMSKYLHGSLIQLGAQN
VHWEENGAYTGEIAAPMLTEIGVRYVIVGHSERREYFGETDATVNLRLKAAQKHGLIPIL
CVGETKQQRDAGETEKLIISQLEKDLVDINQKNLVIAYEPIWAIGTGDTCEATEANRVIG
LIRSQLTNPNVSIQYGGSVKPNNIDEIMAQPEIDGALVGGASLEADSFARIVNYKKID
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccacacaactccgattttgccccttcttctttgtatctttgtacctggaacga
gaaacgaaagcactttccccagccagtatatcaaggaatgtgcaaaaaagtagtacagtg
aaaaatgcatcttgtagcgttagcatgttgacaaaatcacctgtgcgaaaaatcgttatt
gccggtaactggaaaatgttcaaaacctggtcagaatccgaaacattcttacgcggattt
ctgccccacctggaggaaacaccctcagaacgagaaattgtactctgtcctcccttcact
gacttaagcgtcatgtccaaatatttgcatggtagccttatccaactaggcgcacaaaac
gtccactgggaagaaaatggagcctacacaggtgaaattgctgctcccatgctcacagaa
attggtgtgcgctatgtcatagttggtcatagcgaaagacgggaatactttggcgaaaca
gacgcaaccgttaacctccgcctcaaagcagcccaaaagcatgggctaatccccattctc
tgtgttggtgaaaccaaacaacaacgcgacgcaggggaaaccgaaaaactgattatctcc
cagctagaaaaagacttagtggacattaatcaaaagaatttggttattgcttatgaacca
atttgggcaataggaactggtgacacctgtgaagccacagaagcaaatcgggtaattggc
ctaattcgatctcaattgactaatcctaacgtctcaattcaatacggcggttcagtcaaa
ccaaacaatattgatgagattatggcacaaccagaaattgacggcgctcttgtaggaggt
gctagtctagaagctgatagttttgccaggattgttaattataagaaaatagactga

DBGET integrated database retrieval system