KEGG   Anabaena azollae 0708: Aazo_1078Help
Entry
Aazo_1078         CDS       T01260                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
naz  Anabaena azollae 0708
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aazo_1078
   01230 Biosynthesis of amino acids
    Aazo_1078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_1078
   00051 Fructose and mannose metabolism
    Aazo_1078
   00562 Inositol phosphate metabolism
    Aazo_1078
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_1078
Enzymes [BR:naz01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aazo_1078
Exosome [BR:naz04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aazo_1078
  Exosomal proteins of bladder cancer cells
   Aazo_1078
  Exosomal proteins of melanoma cells
   Aazo_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1154528..1155424)
Genome map
AA seq 298 aa AA seqDB search
MIATQLRFCPFFFVSLYLERETKALSPASISRNVQKSSTVKNASCSVSMLTKSPVRKIVI
AGNWKMFKTWSESETFLRGFLPHLEETPSEREIVLCPPFTDLSVMSKYLHGSLIQLGAQN
VHWEENGAYTGEIAAPMLTEIGVRYVIVGHSERREYFGETDATVNLRLKAAQKHGLIPIL
CVGETKQQRDAGETEKLIISQLEKDLVDINQKNLVIAYEPIWAIGTGDTCEATEANRVIG
LIRSQLTNPNVSIQYGGSVKPNNIDEIMAQPEIDGALVGGASLEADSFARIVNYKKID
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgccacacaactccgattttgccccttcttctttgtatctttgtacctggaacga
gaaacgaaagcactttccccagccagtatatcaaggaatgtgcaaaaaagtagtacagtg
aaaaatgcatcttgtagcgttagcatgttgacaaaatcacctgtgcgaaaaatcgttatt
gccggtaactggaaaatgttcaaaacctggtcagaatccgaaacattcttacgcggattt
ctgccccacctggaggaaacaccctcagaacgagaaattgtactctgtcctcccttcact
gacttaagcgtcatgtccaaatatttgcatggtagccttatccaactaggcgcacaaaac
gtccactgggaagaaaatggagcctacacaggtgaaattgctgctcccatgctcacagaa
attggtgtgcgctatgtcatagttggtcatagcgaaagacgggaatactttggcgaaaca
gacgcaaccgttaacctccgcctcaaagcagcccaaaagcatgggctaatccccattctc
tgtgttggtgaaaccaaacaacaacgcgacgcaggggaaaccgaaaaactgattatctcc
cagctagaaaaagacttagtggacattaatcaaaagaatttggttattgcttatgaacca
atttgggcaataggaactggtgacacctgtgaagccacagaagcaaatcgggtaattggc
ctaattcgatctcaattgactaatcctaacgtctcaattcaatacggcggttcagtcaaa
ccaaacaatattgatgagattatggcacaaccagaaattgacggcgctcttgtaggaggt
gctagtctagaagctgatagttttgccaggattgttaattataagaaaatagactga

DBGET integrated database retrieval system