KEGG   Anabaena azollae 0708: Aazo_1186Help
Entry
Aazo_1186         CDS       T01260                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
naz  Anabaena azollae 0708
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aazo_1186
Enzymes [BR:naz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Aazo_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1268639..1270147)
Genome map
AA seq 502 aa AA seqDB search
MPFPRSSGILLHPSSFPSRFGIGDLGLEAYDFIDFLKNSYQQYWQVLPLGPTGYGNSPYM
CYSAMAGNFFLISPEKLVDEGLLVSQDFANLPEFPADKADFEQVIPIKVNLLKKASNNFK
THATDVQRKAFHHFCNTKGYWLNNYALFMAIKDAQNGASWHTWESELAQREAVALAQIEQ
DLAQEIFYYKFVEYEFFRQWSELKSYANQNGIDIIGDIPIYVAHDSADVWANPDNFALDQ
ETGTAALMAGVPPDYFSATGQLWGNPVYNWEELQKQDFKWWVQRFESMLDYVDIIRIDHF
RGFDTYWAVPQGEETAINGEWIEAPGVALFEVIKQKLGKLPILAEDLGIITKEVEGLRDQ
FEFPGMKVLHFAFGSDPGNPFLPFNYPHNAVVYTGTHDNDTTLGWFNTTNDYEKQNLLLY
LGSISPDGISWDLIRLALSSIANQAIIPLQDVLGLGTEARMNYPGKAEGNWDWRYQSGCL
TQELSDRLRIITKLYGRAPRNS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccttttcctagatcaagcggtattttgttacatcccagttcttttcccagtcgtttt
gggattggtgatttgggtttagaagcttatgattttattgattttctcaaaaatagttac
cagcaatattggcaagttttacctctaggtccaactggttatggtaattctccttatatg
tgctattcagcaatggcaggaaatttctttttaattagtcctgaaaagctggtagatgaa
ggtttgttggtttcacaagactttgctaatttaccagaatttccggccgataaagcagac
tttgagcaagtcatacctattaaagtaaatctactcaaaaaagccagcaataattttaaa
actcacgccactgatgtccaaagaaaagcatttcaccatttttgtaacactaaaggctat
tggctcaataattatgctttatttatggcgattaaagatgcccaaaatggagcaagttgg
catacttgggaatcagaactggcacaaagagaagccgtagcgttagcccagatagaacaa
gatttagcacaggaaatattttattacaagtttgtcgaatatgaatttttccgtcagtgg
tcagaattgaagagttatgccaatcaaaacggtatagatattattggtgatatccctatt
tatgtagctcatgatagtgctgatgtgtgggctaatcccgataattttgctttagatcaa
gaaacaggtacagcggctttaatggcaggtgtaccaccagattattttagtgccactggt
caactgtggggcaatccagtctacaactgggaagagttgcaaaaacaagattttaaatgg
tgggtgcaacgttttgagtccatgctagattatgtagatataattcggattgaccacttc
cgaggatttgacacttattgggctgtaccccaaggtgaagaaactgctattaatggtgaa
tggattgaagctccaggagtagccctgtttgaggtgattaaacaaaagttgggtaagtta
cccattttggctgaagatttgggaattattacaaaagaggtcgaaggactgcgagatcaa
tttgagtttcctggtatgaaggtattacattttgcttttggttctgatcccggtaatcca
tttttaccttttaattacccacataacgctgtagtttatactggcactcatgataatgac
acgactttaggttggtttaatactacgaatgattacgaaaagcaaaatttgttgttgtat
ttgggatctataagtcctgatgggataagctgggatttaatcagattagctttaagttcc
atcgccaatcaagcgattattcctttgcaagacgttttaggattgggaaccgaagcaaga
atgaactatcccggtaaggctgagggcaattgggactggcgctatcaatctggttgtttg
actcaagagttgagtgatcgcttaaggattattaccaaactttatggacgcgctcccaga
aattcatga

DBGET integrated database retrieval system