KEGG   Anabaena azollae 0708: Aazo_1254Help
Entry
Aazo_1254         CDS       T01260                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
naz  Anabaena azollae 0708
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aazo_1254
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aazo_1254
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Aazo_1254
Enzymes [BR:naz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Aazo_1254
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1326169..1327260)
Genome map
AA seq 363 aa AA seqDB search
MTLSLSVAKSHRQPWPGLIEAYRKYLPVSESTPVVTLLEGNTPLIPVPALAERIGRQVKV
FIKYDGLNPTGSFKDRGMTMAITKAKEAGAKAVICASTGNTSAAAAAYARRGGMNAFVLI
PDGYVALGKLAQALLYGAEVLAIKGNFDRALEIVREMADHYPITLVNSVNPYRLEGQKTG
AFEVVDALGNAPDWLCIPVGNAGNITAYWMGFCQYHQDQKCDRLPKMMGFQAAGAAPLVS
GKPVANPETLATAIRIGNPASWDQASAAQTASQGSFNAVTDEEILDAYRLLASSEGIFCE
PASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAIKHSHSHFKQGIPADLKAVAEA
MRF
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgactttgagcttgtctgttgctaaatctcatcgccaaccttggcccggactgatagaa
gcctatcgtaaatacttgcctgtcagcgaaagcactccagttgttactctcttggaaggt
aacacacctttaattccagtgccagcgctcgcagaacgcattggcagacaagtcaaggta
tttattaaatatgacggactaaaccccaccggcagttttaaagaccggggtatgactatg
gcgattaccaaggctaaggaagccggggctaaggcagtaatttgtgctagtacaggcaat
acttcagctgctgctgctgcttatgcgcggcgtggggggatgaatgcctttgtgttgatt
cctgatggttatgtggctttgggtaagttagcccaagctttactctatggggctgaggta
ctagctattaagggaaatttcgaccgggcgctggaaattgtccgggaaatggcggatcat
taccccatcactttggtaaattctgtcaatccttaccgcttggaagggcagaaaactggc
gcgtttgaagtggtggatgctttgggtaatgctcccgattggttgtgtattccggtggga
aatgcggggaatatcacagcatattggatgggtttttgtcaataccatcaagatcagaag
tgcgatcgcttgccgaaaatgatgggttttcaagctgctggtgctgcacctttggtaagt
ggtaaacctgtggcaaatcctgaaactttagccacagcaatacgtattggtaatcctgcg
agttgggatcaagcgagtgcagcccaaaccgctagtcaaggcagttttaacgctgtcaca
gacgaagaaattctcgacgcttatcgacttttagcatcatcagaaggtattttctgtgaa
cctgccagtgcagcttctgtagctgggttgttaaaggtaaaagaccaagttcccacaggt
gcaacagtggtttgtgtccttacaggtaatggtttgaaagacccagatacagcaattaaa
cacagtcacagtcattttaaacaaggtattcccgcagacctaaaagctgtagctgaagca
atgaggttttag

DBGET integrated database retrieval system