KEGG   Anabaena azollae 0708: Aazo_1472Help
Entry
Aazo_1472         CDS       T01260                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
naz  Anabaena azollae 0708
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Aazo_1472
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Aazo_1472
Enzymes [BR:naz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Aazo_1472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1540940..1541935
Genome map
AA seq 331 aa AA seqDB search
MSTTTWTRHHILSLADFTTSEYNAVLQTAASFQEVLSRRTKKVPTLQGQVVANLFFEPST
RTRSSFEIAAKRLSADTLNFAAATSSMTKGETILDTAKTYLAMGTDIMVIRHKEAGVPHV
IAQEMDRLGVKVSVLNAGDGQHEHPSQGLLDLFTICTLIDPAQPRIELLEGKKIAIVGDI
LHSRVARSNIWSLIASGAEVYLAGPPTLLPKFFAEYLGRTENSQRLFTHWQLEPALENAD
FVMTLRLQKERMTAHLLPSLREYHQLFGITRNKLKLCKPNVKVLHPGPVNRGVEISSDLM
DDPEFSLIQSQVTSGVAVRMALLYFIGSGRA
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtctactactacctggactcgtcatcatattctttccctagctgacttcacaaccagc
gaatataacgccgttttacagaccgctgcttcatttcaagaagtattatcacgccgaacc
aaaaaggtaccaactctacagggacaggtggtagcaaacttattctttgaaccttcaacg
cgtacccgcagtagttttgagatagctgctaaacgcttaagtgcagataccctaaatttc
gctgctgctacatcttccatgaccaagggagaaaccattctggatacagcaaagacctat
ttagcgatgggaacggatattatggtaattcgccataaagaagcaggagtaccccatgtg
atcgcccaagaaatggatcgtttaggtgtaaaagttagcgtcctcaacgcaggtgatgga
caacatgaacatccatcccaaggattacttgatttatttacaatttgtacattaattgat
ccagcacaacccagaattgaattattagaaggcaaaaaaatagccattgttggagatatt
ctccattctcgcgtagcccgttctaatatttggagtttaatcgctagtggtgcagaagtt
tatctagccggacctcccacattactacctaaattctttgctgaatatttaggacgcaca
gaaaattctcagcgtttatttacacattggcaactagaaccagccttagaaaacgccgat
tttgtgatgacattgcgtttacaaaaagaacgaatgacagcgcatttattaccaagttta
agagaataccatcaactatttggcattacccgcaataaattaaaactctgtaaacccaac
gttaaagttttgcacccaggaccagtaaatagaggtgtagaaattagttctgatttaatg
gatgatcctgaatttagcttaattcaatctcaagtaacgagtggtgttgctgtgcgaatg
gcattgttgtattttattggtagcggtagggcttaa

DBGET integrated database retrieval system