KEGG   Anabaena azollae 0708: Aazo_1566Help
Entry
Aazo_1566         CDS       T01260                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
naz  Anabaena azollae 0708
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:naz01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:naz00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:naz00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:naz00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:naz00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:naz00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1639794..1640762)
Genome map
AA seq 322 aa AA seqDB search
MTLILALDFGGTKLAAATVEAGSREWLDYENRLSPANADALSDIEIMRSLIDSVLGRCKP
DAIGVSFGGPVDAATGLVRLSHHVPGWENIPLKQLLEEEYNVPVSVDNDANVAAVGEHRF
GAGQGYDSLFYITISTGVGGGWILNGKPWQGAGGMAGEIGHIVVDPTGPVCLCGKRGCVE
RLASGPYMAQNARELLEKEAHNSPTSTRGEILKYLVGNDLDLITGQIVSAAAAHGDELAR
EVLYKAAWALGVGIGNVANLMNPQRFVLGGGVTKAGDSFWATVRKVAQETALPEVNFEVV
RALLGDDAPLWGAVALGLDVVK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacattaatattagctcttgattttggtgggactaaactagcagcagccacagtggaa
gctggctctagggaatggttggactatgaaaatcgcctttcacctgcaaatgcagatgct
ttgagtgatatcgaaattatgcgatccctcattgattctgtgctaggtagatgtaaaccc
gatgctattggtgtgagttttgggggaccagtagacgcagccaccggacttgtccgactt
tctcatcatgttcctggttgggaaaatattccccttaaacaactgctagaagaagaatat
aacgttcctgtcagtgtggataatgatgctaatgtcgctgctgtcggtgaacatcgcttt
ggggctggacagggatacgacagcttattttacatcactatcagtacaggtgtgggtggt
ggttggatactcaatggtaaaccttggcagggtgcaggtggcatggcgggggaaattgga
catatagttgtagatcccactgggccagtatgtctgtgtggaaagcggggatgtgtagaa
cgtttagcctccggtccttatatggcacaaaatgcaagggaacttttggagaaagaagct
cataattccccaaccagcaccagaggagaaatacttaaatatttagtaggtaacgattta
gacttaattaccgggcaaatagtgagtgcagcagcagcacatggcgacgaattagccaga
gaagtattatataaagccgcttgggcattaggtgtaggtattggtaatgtggctaacttg
atgaatccccaacgctttgttttaggtggtggtgtcaccaaagccggggatagtttttgg
gctacagtacgcaaggtagcacaggaaaccgcattaccagaagtaaattttgaggtagtg
cgcgcattattgggggatgatgccccgttgtggggggctgtggccttgggtttggatgtt
gtgaagtaa

DBGET integrated database retrieval system