KEGG   'Nostoc azollae' 0708: Aazo_1566Help
Entry
Aazo_1566         CDS       T01260                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00010  Glycolysis / Gluconeogenesis
naz00052  Galactose metabolism
naz00500  Starch and sucrose metabolism
naz00520  Amino sugar and nucleotide sugar metabolism
naz00521  Streptomycin biosynthesis
naz01100  Metabolic pathways
naz01110  Biosynthesis of secondary metabolites
naz01120  Microbial metabolism in diverse environments
naz01130  Biosynthesis of antibiotics
naz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_1566
   00052 Galactose metabolism
    Aazo_1566
   00500 Starch and sucrose metabolism
    Aazo_1566
   00520 Amino sugar and nucleotide sugar metabolism
    Aazo_1566
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aazo_1566
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Aazo_1566
Enzymes [BR:naz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Aazo_1566
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADI63753
JGI: Aazo_1566
UniProt: D7E4J5
Position
complement(1639794..1640762)
Genome map
AA seq 322 aa AA seqDB search
MTLILALDFGGTKLAAATVEAGSREWLDYENRLSPANADALSDIEIMRSLIDSVLGRCKP
DAIGVSFGGPVDAATGLVRLSHHVPGWENIPLKQLLEEEYNVPVSVDNDANVAAVGEHRF
GAGQGYDSLFYITISTGVGGGWILNGKPWQGAGGMAGEIGHIVVDPTGPVCLCGKRGCVE
RLASGPYMAQNARELLEKEAHNSPTSTRGEILKYLVGNDLDLITGQIVSAAAAHGDELAR
EVLYKAAWALGVGIGNVANLMNPQRFVLGGGVTKAGDSFWATVRKVAQETALPEVNFEVV
RALLGDDAPLWGAVALGLDVVK
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgacattaatattagctcttgattttggtgggactaaactagcagcagccacagtggaa
gctggctctagggaatggttggactatgaaaatcgcctttcacctgcaaatgcagatgct
ttgagtgatatcgaaattatgcgatccctcattgattctgtgctaggtagatgtaaaccc
gatgctattggtgtgagttttgggggaccagtagacgcagccaccggacttgtccgactt
tctcatcatgttcctggttgggaaaatattccccttaaacaactgctagaagaagaatat
aacgttcctgtcagtgtggataatgatgctaatgtcgctgctgtcggtgaacatcgcttt
ggggctggacagggatacgacagcttattttacatcactatcagtacaggtgtgggtggt
ggttggatactcaatggtaaaccttggcagggtgcaggtggcatggcgggggaaattgga
catatagttgtagatcccactgggccagtatgtctgtgtggaaagcggggatgtgtagaa
cgtttagcctccggtccttatatggcacaaaatgcaagggaacttttggagaaagaagct
cataattccccaaccagcaccagaggagaaatacttaaatatttagtaggtaacgattta
gacttaattaccgggcaaatagtgagtgcagcagcagcacatggcgacgaattagccaga
gaagtattatataaagccgcttgggcattaggtgtaggtattggtaatgtggctaacttg
atgaatccccaacgctttgttttaggtggtggtgtcaccaaagccggggatagtttttgg
gctacagtacgcaaggtagcacaggaaaccgcattaccagaagtaaattttgaggtagtg
cgcgcattattgggggatgatgccccgttgtggggggctgtggccttgggtttggatgtt
gtgaagtaa

DBGET integrated database retrieval system