KEGG   Anabaena azollae 0708: Aazo_1827Help
Entry
Aazo_1827         CDS       T01260                                 

Definition
phosphoketolase (EC:4.1.2.9)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
naz  Anabaena azollae 0708
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Aazo_1827
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_1827
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Aazo_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1893999..1896380
Genome map
AA seq 793 aa AA seqDB search
MTLASTRQIKPLSDTELQKINAYWRAANYLSVGQIYLLDNPLLKEPLKIDHVKPRLLGHW
GTTPGLNLIYAHLNRVIKKYDLSTIYIAGPGHGGPGLVANTYLEGTYSEYYPNISQDAGG
MRKLFKQFSFPGGIPSHVAPETPGSIHEGGELGYALVHAYGAAFDNPDLIVAAVVGDGEA
ETGALATSWHSNKFLNPVTDGAVLPILHLNGYKIANPTILARIPHEELESLFIGYGYKPY
FIEGSDPADVHQKMAATLDIVIAEIQGIQREVRIHGFKKRSQWPMIILRTPKGWTGPKEV
DGKKTEDYWRSHQVPFGDIAGRAEHLQLLEDWMKSYKPEELFDANGQLLPELAELAPTGQ
RRMGDNPYANGGILLRDLIMPDFSNYAVEVPKPGTVNAEATKVTGKFLRDIMKENQESHN
FRVFGPDETASNRIDPVLEVTNRTWVAETLPEDDHLSPNGRVMEMLSETNCQGWLEGYLL
TGRHGFFSCYEAFIHIIDSMFNQHAKWLKTTRHISWRRPIASLNYLLTSHVWRQDHNGFS
HQDPGFLDHVINKKSEIIRVYLPPDANTLLSVTDHCLRSRNYVNVIVAGKQPALQYLDID
TAIKHCTKGLGIWEWASSDQGGDTDVVMACAGDIPTLETLAAVDILRQYFPELKVRVVSV
VNLMKLQPQSEHPHGLTSKEFDTIFTTDKPVIFAFHGYPWLIHRLTYRHTNHKNLHVRGY
KEEGTTTTPFDMVVMNDLDRFHLVMDVIDRVPKLGYKGAYVKQKLQDKLIEHKYYIEKYG
EDMPEIRDWTWSY
NT seq 2382 nt NT seq  +upstreamnt  +downstreamnt
atgacattagccagcactcgacaaataaagccattatcagacacagaattacaaaaaatc
aacgcttattggcgtgcagccaactatctctcagtcggacaaatatacctactcgacaac
cccctactgaaagaaccgctaaaaatagatcatgttaaaccgcgtttgttaggacattgg
ggaacaactccagggctgaacttaatatatgcccacctcaatcgcgtcattaaaaaatat
gacctcagcaccatttatattgctgggcctggacacggtggacccggacttgtcgctaat
acttacttagaaggcacatacagcgaatattaccccaacatctcccaagatgctgggggg
atgcgaaaactatttaaacaattctcttttcctggtggtattcccagtcacgtcgcacca
gaaacccctggttctatccatgaaggaggagaactgggttatgctttagttcacgcctat
ggtgctgcttttgacaaccctgatttaattgtcgctgctgttgtcggtgatggagaagca
gaaaccggcgctttagctaccagttggcattctaacaaattcctcaaccctgttactgat
ggggcggttcttcccattttacatttaaatgggtataaaattgccaatcctactatttta
gcacggataccccatgaagaactagaaagtttgtttattggctatggctataaaccatac
tttatcgaaggttctgaccctgcggatgttcaccaaaaaatggcggcaactttagatata
gttattgccgaaattcaaggtatccaaagagaagtgcggatacatggtttcaaaaagcga
tcgcaatggccgatgataatattacgtactcctaaaggttggactggaccaaaggaagta
gatggtaagaaaacagaagattattggcgatcacaccaagtcccatttggtgatatagct
ggtagagcagaacatctgcaactactagaagactggatgaagagttacaaaccagaagaa
ctatttgacgcaaacggtcaactccttcccgaactggcagaactcgcacctacaggtcag
cgtcgcatgggagacaacccctacgcaaacggcggtatattgctgcgtgatttaatcatg
ccagacttttccaactatgcagtagaagttccgaaaccaggaacagttaacgcagaagcc
accaaagtgaccggcaaattcctgcgggatatcatgaaagaaaaccaggaaagccacaac
tttcgagttttcggacccgacgaaaccgcatctaaccgcatcgacccagtgttagaagtc
acaaatcgtacttgggttgctgaaactctcccggaagatgaccatttatcacctaatggt
cgggtaatggaaatgcttagcgaaacaaactgtcaaggatggttagaaggatatctgctt
acaggtcgtcatggtttcttctcctgttatgaagcatttattcatatcattgactcgatg
tttaaccaacacgctaaatggttaaaaacaactcgtcatatttcttggagaagaccaatt
gcatctttaaattatcttctcacttcccatgtttggcgacaagatcataacggtttctct
caccaagatcctggttttctagatcatgttattaataaaaagtccgaaattattcgcgtc
tatctgccacctgatgctaacactttgttatcagtaaccgaccactgtttaagaagtcgt
aactatgtcaatgtcattgtggctggaaaacaacctgcattacaatatttagacatagat
acagctattaaacactgtaccaaaggtttaggaatttgggaatgggcaagtagtgatcaa
ggtggtgacactgatgtagtgatggcttgtgctggggatattccaactttagaaacctta
gcagcagtggatattttgcgtcagtatttcccagaactaaaagtgcgggtagtgagcgta
gttaatttgatgaaactacagccacaaagtgaacatcctcacggtttaaccagcaaagag
tttgatactatttttaccactgataaaccggttatttttgctttccatggttatccttgg
ttaattcatcgtctcacctatcgtcatactaaccacaaaaatcttcatgtacgtggttat
aaggaggaaggaacaacaaccacaccttttgatatggtggtgatgaatgatctagataga
ttccatctggtcatggatgtaattgaccgtgtacccaagttgggttataaaggcgcttac
gtgaagcaaaaattacaagataagttgattgaacataagtattacattgagaaatacggc
gaagatatgccggaaattcgagattggacttggtcctattag

DBGET integrated database retrieval system