KEGG   Anabaena azollae 0708: Aazo_1890Help
Entry
Aazo_1890         CDS       T01260                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
naz  Anabaena azollae 0708
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Aazo_1890
   00670 One carbon pool by folate
    Aazo_1890
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Aazo_1890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1962580..1963080
Genome map
AA seq 166 aa AA seqDB search
MALISLIAAISENRILADSKKEHIRVGIPWDIPSDLQHFQKKTWRHPVILGRKSYAAFNH
PLPNRTNIILTRSHDYKAPGCLVFYSLSEAVTWAKMSEKEEIFIAGGGEIFAEAIKFANK
LYLTIVEGNFEGDVYFPEFTNFGTVTKEEHSQENDFQFKFVEIERF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggctctgattagtctcattgctgccatttccgaaaatcggattttagctgactcaaaa
aaggaacacattcgtgtaggtattccttgggatattcctagcgatctacaacattttcag
aaaaaaacctggcgacatcctgtgattctcggtcgtaaaagctatgctgcttttaatcat
ccgttgccaaatcgtacaaatataatccttactagaagtcatgattataaagctcccggt
tgtcttgttttttattcactatctgaggcagttacatgggctaaaatgagtgaaaaggag
gaaatatttattgcgggtggaggagaaatttttgcagaagcaattaaatttgctaataag
ctgtatttaacaattgtagaaggtaattttgagggagatgtatactttcctgaatttacc
aattttggcacagtaacgaaagaagagcattcccaggaaaatgactttcagtttaagttt
gtggagattgaaaggttttag

DBGET integrated database retrieval system