KEGG   Anabaena azollae 0708: Aazo_1890Help
Entry
Aazo_1890         CDS       T01260                                 

Definition
dihydrofolate reductase subunit
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
naz  Anabaena azollae 0708
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:naz00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:naz00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1962580..1963080
Genome map
AA seq 166 aa AA seqDB search
MALISLIAAISENRILADSKKEHIRVGIPWDIPSDLQHFQKKTWRHPVILGRKSYAAFNH
PLPNRTNIILTRSHDYKAPGCLVFYSLSEAVTWAKMSEKEEIFIAGGGEIFAEAIKFANK
LYLTIVEGNFEGDVYFPEFTNFGTVTKEEHSQENDFQFKFVEIERF
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggctctgattagtctcattgctgccatttccgaaaatcggattttagctgactcaaaa
aaggaacacattcgtgtaggtattccttgggatattcctagcgatctacaacattttcag
aaaaaaacctggcgacatcctgtgattctcggtcgtaaaagctatgctgcttttaatcat
ccgttgccaaatcgtacaaatataatccttactagaagtcatgattataaagctcccggt
tgtcttgttttttattcactatctgaggcagttacatgggctaaaatgagtgaaaaggag
gaaatatttattgcgggtggaggagaaatttttgcagaagcaattaaatttgctaataag
ctgtatttaacaattgtagaaggtaattttgagggagatgtatactttcctgaatttacc
aattttggcacagtaacgaaagaagagcattcccaggaaaatgactttcagtttaagttt
gtggagattgaaaggttttag

DBGET integrated database retrieval system