KEGG   Anabaena azollae 0708: Aazo_2376Help
Entry
Aazo_2376         CDS       T01260                                 

Definition
signal transduction histidine kinase with CheB and CheR activity
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
naz  Anabaena azollae 0708
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:naz02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:naz02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2471036..2475259
Genome map
AA seq 1407 aa AA seqDB search
MNSRRSSNKSEADDSTAKASPQQQGKQKDLFPIVGIGASAGGLEAFTQLLNHLPADTGMG
FVLVQHMNPQEKSMLTEILSPTTQMVVTEAEEAMSVKPNHVYVIPPNATMTIREGVLKLK
PREKTYGLSMTVDGFFFSLAEDLGNKAIGVVLSGGDGDGTRGLESIKAVGGMTFAQCEES
AKVSSMPNTAMASGYVDFILTPEQIAEKLVKISFHPYINHSTPLKPTEVMPKKTDALLKI
FNLLRVATGVDFSYYKQTTLKRRIQRRIILYKLDQMEDYVNYLQNNPAEVIALYQDVLIT
VTSFFRDSEAFEALKTKVFPDMLTKQRKANDPIRIWVVGCSTGEEAYSIAICLLEFLTNR
GINIPIQIFATDINEVAIEKARIGIYKLHQVAEISPERLNRFFVHIDSGYQITKSVRDLC
VFARQNLINDPPFSRLDLITCRNVLIYLGSTAQQKLLPIFHYGLKPTGFLMLGTSETVGE
FADLFNLVDKKYKIYARKIASTRLPIEPITSNYPVETTKSPLLISNDSWNDVEIHKEADR
IVLNKFAPVGVIINNDLEILQFRGQTSRYLQPAPGRPSFNLLKMAKEELRLELRSSVHQA
KKQAIATKTEGIRIKEENKFRMVNIHVIPLPILGAGEDFFLVLFEDIPLSESLLTAADSN
IKPEQETKNSYEQEITVLQHELTSTKDYLQSIIEEQQASNQDLRAANEEILSSNEELHST
NEELETAKEEIQATNEELNSINDELQRRNIEATLVSNDLQNLFSSINISILMVGSDLKIR
CFNIAAEIIFNLIPTDKGRPLSNIKHKLKVPNLEAKIVEVISTSNLKTQEVQDLDGHWYD
LRIRPYRTIDNKIDGAVVILVDIDDIRRNANILKSFREYAAAIVSTVRESLVVMDVDLKV
VTANQFFYEAFQVGAKETENRLIYEIGDGQWNIPQLRSLLEDTIPQQGQFQDVEIEHDFE
QIGHKIMRLNGRKITQIGDTPMIILVIEDITQRKQLEAERTQLLAQEQSARTAAETANCA
KDEFLSVLSHELRNPLNCLLGWTQLLRKQQLDEAKTNQALEAIERSAKAQHQLIGDLLDI
SRISVGQMRLEAQPVKLIPVIEAAIDVVQLAADAKNIQIQSRLDSAGRTLVGDQIRLQQV
IWNLLSNSIKFTPVGGRIDITLDYSPFQGEIQVRDTGVGISADFLPYIFDRFRQADRSPT
RSNTGLGLGLSIVRHLVELHGGTVEVTSPGEGQGATFTVRLPLQTNLEKILETSAIANPQ
NPVIYPASPASNSPVSSPSLAGVRVLMVDDEADIRQLFQIVLEEYGIQVTEAGSVKEALS
ILKANPHGYDVLLSDIGLPEEDGYALIRQVRSLSAEEGGQIPAAAMTAYAGDTDQTEALS
AGFQTHVAKPIEPNRLISVVAALAGRI
NT seq 4224 nt NT seq  +upstreamnt  +downstreamnt
atgaactctaggcggtcttctaacaaatctgaagctgatgattccaccgctaaagcatcc
ccacagcaacaggggaaacaaaaagatttatttccaattgtcgggattggagcctctgcg
gggggattagaagcatttacacaactcttaaaccatttaccagcggatacaggtatggga
tttgtgctggttcagcacatgaacccccaggaaaaaagtatgttaacagagattctttct
ccgacaacccaaatggtggtgacagaggccgaggaagcgatgtctgtgaaaccgaatcat
gtttatgtgattccgcccaatgcaacaatgaccattagagaaggagtgctgaaactgaag
ccccgtgagaagacttatggcctctcaatgacagttgatggtttctttttttccttagca
gaggatttgggtaacaaagccattggagttgtgctgtcagggggtgatggagatggaaca
aggggtttagaaagcatcaaggcagtaggtgggatgacttttgctcaatgtgaggaatca
gcaaaagttagtagtatgccgaatacagcgatggcttctggttatgtagactttatcctc
acccccgaacaaattgccgaaaaactagtaaagatcagctttcatccctatattaaccac
tcaacacctctcaaaccgactgaagttatgccgaaaaaaacagatgctttgttaaagatt
ttcaatttgctacgggtagctacaggtgttgactttagttattacaaacagactacccta
aagcggcgaattcaacggcgaataatattgtataaactggatcagatggaagattacgtt
aattatctccagaataatccagcagaagtcatcgcattgtatcaagatgtcttaattact
gtcaccagttttttccgagattcagaagcttttgaagctttaaaaaccaaagtatttcca
gatatgcttactaagcagcgtaaagccaatgatcccattcgtatatgggttgtgggatgt
tcaactggtgaagaagcctactcgattgctatatgtttgctggaatttttaactaatcgg
ggaattaatatacccatccagatttttgctacagatatcaatgaagtggcaatagaaaaa
gctagaatcggtatctacaaactgcatcaagtagcagagatttctccagaacgattaaac
cgtttctttgttcatatagacagtggctaccagattactaaatcagtcagagacctgtgt
gtttttgccagacagaacttgattaatgatcccccattttctcggctagatttgatcact
tgtcggaatgtcttgatttatttgggttctactgctcagcaaaagctcctccccatcttt
cattatggtcttaaacctacaggttttttgatgttaggcacatcggagacagtgggggaa
tttgctgacttgtttaatttagtggataaaaagtacaagatttatgcgcggaaaatagca
tctacccggctccctattgagccaataactagtaactatcctgtggaaaccacaaaatct
ccactgctaataagtaatgattcgtggaatgatgtggaaatacacaaagaggctgacaga
attgtattaaataaattcgcacctgtaggtgtgattattaacaatgatctggagatttta
caattccgaggtcagacaagtcgctatttacaacctgcaccaggtagacccagtttcaat
ttgctgaaaatggccaaagaagaattgcggctagagttacgtagctcagttcatcaagct
aaaaagcaagccatcgccactaaaacagaagggatacgaattaaagaagaaaacaaattt
aggatggtaaacatccatgtgattcccttgccaattcttggtgcaggagaagactttttt
ttagttttgtttgaggatatccccctttcagaaagtttgctaacggcagcagatagcaat
attaaacctgaacaggaaacaaaaaacagttatgagcaggaaattactgttcttcagcac
gaattaacatctactaaagactatctgcaatcaataattgaggaacagcaagccagtaat
caggatttgagagcagctaatgaagaaatactctccagtaatgaggagttgcacagtacc
aatgaagaattggaaactgctaaggaagaaattcaggctaccaatgaagaattaaatagt
attaacgacgaactgcaacggcgaaatatagaagcgactctggttagtaacgatttacaa
aatctctttagtagtattaatatttctatcctgatggtagggagtgatttaaagattcgc
tgctttaatatagcagcagagatcatatttaacttaattcctactgataagggacgacca
ttgagtaatattaaacacaaattaaaagtccccaatttagaagcaaagattgtagaagta
attagcacctcgaacttgaaaacgcaggaggtgcaagatttagatggtcattggtatgat
ctacgcatcagaccatatcggactattgacaacaaaattgatggtgcggtggtaattttg
gttgatattgatgatatcagacgtaatgctaatatcctcaaatcattccgtgaatatgca
gcggcaattgtgtctaccgtgcgggaatctttggtggtgatggatgtagatttaaaagtg
gttactgctaatcagtttttctatgaagcattccaggtgggagcaaaagaaacagaaaat
cgcctcatttatgaaatcggtgatggacagtggaatattccccagttgcgctcgctcttg
gaagatactatcccccaacaaggccagtttcaagatgtagaaattgagcatgactttgag
caaatcggtcacaaaattatgcgcctcaatggccgaaaaattacgcaaataggtgatacg
ccaatgattatcctggtaattgaggatatcacccaacgcaagcaattagaagcagaacgg
actcaactcctagctcaagaacaatcagcccggactgcggcagaaacagccaactgtgct
aaggatgagtttttatctgttctttctcatgagttacgtaatccgctgaattgtctgcta
gggtggacgcaattgctacgaaaacagcagctggacgaagccaagactaatcaggcattg
gaagccattgagcgcagtgctaaggcacaacatcagctgattggggatttattggatatc
tcccgtattagcgttgggcagatgcgtctggaagcacagcctgttaagcttattcctgtg
attgaagcggcgatagatgtggtgcaattggccgcagatgctaaaaacattcaaattcaa
tcgagactcgattctgctggaagaaccttggttggagatcaaattcgcttacaacaggtg
atttggaatttactttccaactcgattaaatttactcctgtgggtggaagaattgatatc
accttagattacagtccttttcaaggtgaaattcaagttagggacactggggtaggtatc
agcgcagactttctgccctatatttttgaccgcttccgtcaggctgatcgtagcccaacc
aggtcaaatactggactaggattgggactttcgattgtgcgacatttggtagaactccac
ggtggtacagtggaagtgacaagtccaggtgagggtcaaggtgctacttttactgttaga
ctacctctgcaaactaatctagaaaagattttagaaacgagtgctatagcaaatcctcaa
aatccagttatttatccggcttctcctgcttccaactcccctgtctcttccccatcatta
gctggtgtgcgggtgctgatggtcgatgatgaagcagatattcgtcaattatttcaaatc
gtgctggaagagtatggaatacaagtaacagaggcaggatcggtaaaagaagctttatca
atactcaaggctaatcctcatggatatgatgtgcttctatctgatattgggctaccggag
gaagatggttatgcgctaattcgtcaggtccgatcgctcagtgccgaagaaggagggcag
attcctgctgctgcaatgacagcctatgctggagatacagaccaaacagaggccttgtcc
gcaggattccaaactcatgttgctaaacccatcgaacccaatcgcttaatttcagtggtt
gcagcattggctggtcggatttaa

DBGET integrated database retrieval system