KEGG   Anabaena azollae 0708: Aazo_2472Help
Entry
Aazo_2472         CDS       T01260                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
naz  Anabaena azollae 0708
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:naz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aazo_2472
Enzymes [BR:naz01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Aazo_2472
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2573059..2573697
Genome map
AA seq 212 aa AA seqDB search
MISYLKGIVACIQAISSNRVILTLEVNGLGYDLQVPQRLANQLTTTGDVVQIFTHYQVRE
EVPLLYGFSSPAERDLFRHLLSVTGIGAALAITLLDTLELPELVQAIIAANTQILIQAPG
VGKKTAERICLELKSKLIEWRKSAAFFVATGGPAPGILEEVQMTLFALGYTAHEVSHALH
VVSENIGLPKDAYVEDWIKQAIGHLSSTQAGV
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgattagctatctaaaaggtatcgtcgcttgtatccaagcaattagctctaatcgtgtc
attttgaccttagaggtaaacgggttgggttacgatttgcaagttccgcaacgtttagcc
aaccaattaacgactactggagatgtggtacaaatttttacccattaccaggttcgggaa
gaagtgcctttactctatggtttttcttcaccagccgaacgggatttatttcgtcattta
ttaagtgtgactggtattggtgcagccttagcaatcacacttttggacactttggaatta
ccagagttagttcaagcgattattgctgctaatacccaaattttaattcaagcgcctggt
gtgggcaaaaagaccgctgaacgcatctgtttagaactgaaaagcaagttgattgaatgg
cgcaaatcagcagcctttttcgtggctacaggtgggccagcaccagggatactggaagaa
gtgcaaatgacactctttgctttgggatatactgcccatgaagtcagtcatgccttgcac
gtagttagcgaaaatattggtttacccaaagatgcctatgtggaagattggattaaacaa
gcgatcggacatcttagcagtacccaagccggagtgtag

DBGET integrated database retrieval system