KEGG   Anabaena azollae 0708: Aazo_2876Help
Entry
Aazo_2876         CDS       T01260                                 

Definition
family 3 glycoside hydrolase domain-containing protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
naz  Anabaena azollae 0708
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Aazo_2876
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Aazo_2876
Enzymes [BR:naz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Aazo_2876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2960488..2961579
Genome map
AA seq 363 aa AA seqDB search
MSPSQHIQSFGNHLILGVSGTSLNDDDKRALSELKPVGVIFFAKNFLDGVPYQIWVENFN
QLNHSIREYTERTFMFMTIDHEGGRVVRMPLPITRFPLSYLLKFHAQEVAKATACELRSL
GINVSWSPVADIFSNPQNPIIGPRAFGTTPETASQRAREYYRGLKQGGMITCAKHFPGHG
DTSQDSHVELPTLNLTVEELQRRELIPFKTLIEEQIPLIMTAHILFPQIDAEVPATLSRT
ILNHILREELNFQGVVVSDDLDMKAVSEMFMQSGTVARAFYAGCDLFIVSRNINSSSIER
TYQIAEDFTASLSNGSLDEKVVVAARERIEKLLEGTPQYPVYALEKEILVKNAELAITST
FTI
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccatcacaacatatccaaagctttggtaatcatctgattctcggtgtttctgga
acaagcctcaatgatgatgataaaagggcgttaagtgaattaaaacctgttggggtgata
tttttcgccaaaaactttcttgatggtgtaccatatcagatttgggtagaaaattttaac
caactaaatcacagtatacgtgaatatactgaacgtactttcatgtttatgaccatagat
catgaaggtggaagagttgttagaatgccattaccgattactcgatttcctctcagttat
ctattaaaatttcatgcgcaagaagtagctaaggcaactgcttgcgaattaagatcacta
ggaatcaatgtttcttggtctcccgttgctgatattttctccaacccccaaaacccaatt
attggaccccgcgcttttggaactactcctgaaaccgctagtcaacgtgcgcgggaatat
tatcggggactcaagcaaggaggtatgatcacttgtgcaaaacattttcctggacatgga
gacaccagccaagattctcacgtggaattaccaactctcaatttaactgtagaggaattg
caaagacgggaattaatacctttcaaaacattgattgaggaacagataccgttgattatg
actgcccatatcctgttcccgcaaatagatgctgaagttccagccacattgtcaaggacg
attttaaatcacatcctgcgggaagaactcaattttcagggtgtggttgtttccgatgac
ttggatatgaaagccgtctctgagatgtttatgcagtcgggaacagtagcgcgggctttt
tatgcaggttgcgatttatttattgtttctcgcaatatcaattcttcttcaatagaaagg
acatatcaaatagctgaggattttaccgcttctttgagtaacggcagcttggatgagaaa
gttgtagtagcagcaagggagagaattgagaaattattggaaggaactccccaatatcca
gtgtatgccctggaaaaagagattttagtcaaaaatgcagaattagcgatcacttctact
tttaccatttaa

DBGET integrated database retrieval system