KEGG   Anabaena azollae 0708: Aazo_2960Help
Entry
Aazo_2960         CDS       T01260                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
naz  Anabaena azollae 0708
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aazo_2960
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aazo_2960
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Aazo_2960
Enzymes [BR:naz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Aazo_2960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3042812..3044116
Genome map
AA seq 434 aa AA seqDB search
MTQAIANLNQANTSILKALKCKECGAEYELQASHVCELCFGPLEVKYDYDVLRQSVSRKS
IETGPNSIWRYRHFLPITTDNYIDVGTGMTPLVRSQRLARRLGLNKLYIKNDAVNMPTLS
FKDRVVTVALSRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLEAGKVLGS
LIYSPTLMAVKGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGFEVAEQLGWEL
PDHIVAPLASGSLFTKIYKGFKEFTEVGLLEGKNVRFSGAQAEGCSPIATAFKEKRDFIQ
PVKPNTIAKSIAIGNPADGVYAVEIAQKTGGNIESVNDAEIINGIKLLAETEGIFTETAG
GTTVAVLKKLVEAGKIDPDETTVVYITGNGLKTQEAIQGYVGEPLTIDAKLDSFERALER
SRTLDRLEWQQVLV
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgactcaggcgatcgcaaacttaaaccaagccaacacttccatattgaaagcactgaag
tgtaaagaatgtggagcagaatatgaactccaagctagtcatgtttgtgagttatgcttt
ggtccattggaagtaaagtatgactatgatgttttgcgtcagtctgtaagtcgaaaaagt
attgaaactggtcccaactctatttggcgttatcgtcactttttacccattactaccgat
aattacatagatgtgggaacgggtatgactcccctggtacgttcccagcgtcttgcccgt
cgcctgggtttaaataaactttatattaaaaatgatgccgtcaacatgcctaccctgagc
tttaaggatcgggtggtaacagttgcactaagtagagctagagaattaggatttacgact
gtttcctgtgcaagtactggcaacttggcaaattcaaccgctgcgatcgcagcccatgct
ggtttagattgttgtgtttttattcctgctgacttagaagctggtaaagtattgggtagc
ttaatttacagccctactctcatggctgtaaaaggaaattacgatcaagttaaccgtctc
tgctcagaagttgctaatacacacggctggggttttgtcaatattaatttacgtccttat
tactccgaaggttccaaaacactaggctttgaagttgcagaacaactagggtgggaacta
cctgaccatatagttgcaccactcgcttctggttctctcttcaccaaaatttataaaggt
ttcaaagaatttacagaagttggtttgctagaaggtaagaatgttcgtttcagcggcgca
caagcggaaggatgttcccccatagccacagcttttaaagaaaaaagagactttattcaa
cccgttaaaccgaataccatcgctaaatctatcgccattggcaacccagcagatggagtt
tatgctgtagaaatcgctcaaaaaacaggcggtaacattgaatctgtcaatgatgcagaa
attattaacggtatcaaactactagcagaaactgaaggtatcttcacagaaaccgcaggt
ggtacaactgttgccgtcctgaaaaaattagtagaagctggcaaaatagatccagatgaa
actacagtggtttacatcactggtaacggtttaaaaacccaagaagcaattcaaggttat
gttggagaacctttgactattgatgccaaacttgatagttttgaacgggcgctagaaaga
tcccgcacactggatcgcctagaatggcaacaagttcttgtttag

DBGET integrated database retrieval system