KEGG   'Nostoc azollae' 0708: Aazo_3367Help
Entry
Aazo_3367         CDS       T01260                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00790  Folate biosynthesis
naz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Aazo_3367
Enzymes [BR:naz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Aazo_3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ADI65025
JGI: Aazo_3367
UniProt: D7E2V7
Position
complement(3432279..3432986)
Genome map
AA seq 235 aa AA seqDB search
MTIASSNASNRSQSPLIPDLSQAISTRPDRNTHNGKQADLHPPSEESMEQMMEAVRTMLI
GVGEDPEREGLLKTPKRVAEAMMFLTGGYNQSLEELVNGAIFDEGHNEMVLVRDINFFTL
CEHHMLPFMGRAHVAYIPNQKVVGLSKMARIVEMYSRRLQVQERLTRQIAEAVQTILEPK
GVAVVMEATHMCMVMRGVQKPGSWTVTSSMVGVFQDEQKTREEFLNLIRHQPAFF
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactatcgctagctccaacgcttccaatcgctcacaatctcctctgattcctgactta
tcacaagctatcagtaccagacctgaccgcaacacccataatggtaagcaggcggatttg
cacccaccttcagaggaaagcatggagcaaatgatggaagctgtgcggacaatgctcata
ggtgttggagaagatccagaacgtgaaggattactcaaaacacccaagcgcgtagctgaa
gcaatgatgtttctcactggtggctacaaccaatctttagaagaactggtgaatggtgcc
atttttgatgaaggccataacgagatggtgctagtacgagatattaatttctttactctc
tgcgaacatcatatgctgccatttatgggcagagcgcacgttgcttatattcctaatcaa
aaagtcgtgggtttaagtaagatggcgcgaattgtagaaatgtattctcgtcgcttacaa
gtgcaagaaaggctaactcgacaaattgctgaagcagtccagacaattcttgaacctaaa
ggtgttgcggtggtcatggaagctacccatatgtgtatggtgatgcgcggtgtacaaaaa
cctggttcttggacagttaccagttctatggtgggtgtgttccaagatgagcaaaaaacc
cgtgaagagttcttgaatttgattcgtcatcaacctgcattcttttaa

DBGET integrated database retrieval system