KEGG   Anabaena azollae 0708: Aazo_3554Help
Entry
Aazo_3554         CDS       T01260                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
naz  Anabaena azollae 0708
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Aazo_3554
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Aazo_3554
Enzymes [BR:naz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Aazo_3554
Lipid biosynthesis proteins [BR:naz01004]
 Desaturase
  First
   Aazo_3554
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3623752..3624570
Genome map
AA seq 272 aa AA seqDB search
MTIATSTKPQINWVNTLFFIALHIGALFAFFPGNFSWTAVGVALFLYWVSGGLGITLGFH
RLVTHRSFQTPKWLEYFLVFCGTLACQGGPIEWVGTHRIHHLHSDTEQDPHDSNKGFWWS
HIGWLIFHSPAHSQIPRFTKDIAGDPVYQFFQKYFILIQLVLGAVLLFLGGWSFVVWGVF
VRIVWVYHCTWLVNSATHKFGYQSHDSGDRSTNCWWVAVLVFGEGWHNNHHAYQYSARHG
LEWWEIDMTWMTIQLLQLFGLATNVKLAERKA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgctacctcaactaaacctcaaattaactgggttaataccctatttttcatc
gctctgcacatcggtgctttatttgccttttttcctggtaactttagctggacagccgtt
ggtgttgcattattcctctactgggtgagtggtggtttaggcattactctgggttttcac
cgtctcgttacccatcgaagttttcaaacccctaaatggttggagtattttctggtgttc
tgtggtactcttgcctgtcaaggtggaccaattgagtgggtagggacacatcgtattcat
catttgcattctgatactgaacaagatccgcatgattctaataagggtttttggtggagt
cacatcggttggctaattttccactctcctgcgcactcccaaattccccgatttacaaag
gatattgcaggagacccagtttatcagtttttccaaaagtatttcattttaatccagtta
gttctgggtgcagtgttattatttttgggtggttggtctttcgtggtttggggcgttttt
gtccgcatcgtttgggtttatcactgcacatggttagtgaacagtgctacccataagttc
ggttaccaaagtcatgactctggcgacagatctactaactgctggtgggttgctgtacta
gtatttggtgaaggctggcataataaccaccatgcttatcaatactcagcccgtcatggt
ttggaatggtgggaaattgatatgacttggatgactattcaattactacaactcttcggt
ctcgctacaaatgtcaagctggcagagcgaaaagcataa

DBGET integrated database retrieval system