KEGG   Anabaena azollae 0708: Aazo_3554Help
Entry
Aazo_3554         CDS       T01260                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
naz  Anabaena azollae 0708
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:naz01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:naz01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3623752..3624570
Genome map
AA seq 272 aa AA seqDB search
MTIATSTKPQINWVNTLFFIALHIGALFAFFPGNFSWTAVGVALFLYWVSGGLGITLGFH
RLVTHRSFQTPKWLEYFLVFCGTLACQGGPIEWVGTHRIHHLHSDTEQDPHDSNKGFWWS
HIGWLIFHSPAHSQIPRFTKDIAGDPVYQFFQKYFILIQLVLGAVLLFLGGWSFVVWGVF
VRIVWVYHCTWLVNSATHKFGYQSHDSGDRSTNCWWVAVLVFGEGWHNNHHAYQYSARHG
LEWWEIDMTWMTIQLLQLFGLATNVKLAERKA
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgctacctcaactaaacctcaaattaactgggttaataccctatttttcatc
gctctgcacatcggtgctttatttgccttttttcctggtaactttagctggacagccgtt
ggtgttgcattattcctctactgggtgagtggtggtttaggcattactctgggttttcac
cgtctcgttacccatcgaagttttcaaacccctaaatggttggagtattttctggtgttc
tgtggtactcttgcctgtcaaggtggaccaattgagtgggtagggacacatcgtattcat
catttgcattctgatactgaacaagatccgcatgattctaataagggtttttggtggagt
cacatcggttggctaattttccactctcctgcgcactcccaaattccccgatttacaaag
gatattgcaggagacccagtttatcagtttttccaaaagtatttcattttaatccagtta
gttctgggtgcagtgttattatttttgggtggttggtctttcgtggtttggggcgttttt
gtccgcatcgtttgggtttatcactgcacatggttagtgaacagtgctacccataagttc
ggttaccaaagtcatgactctggcgacagatctactaactgctggtgggttgctgtacta
gtatttggtgaaggctggcataataaccaccatgcttatcaatactcagcccgtcatggt
ttggaatggtgggaaattgatatgacttggatgactattcaattactacaactcttcggt
ctcgctacaaatgtcaagctggcagagcgaaaagcataa

DBGET integrated database retrieval system