KEGG   Anabaena azollae 0708: Aazo_3680Help
Entry
Aazo_3680         CDS       T01260                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
naz  Anabaena azollae 0708
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:naz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aazo_3680
DNA repair and recombination proteins [BR:naz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Aazo_3680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3741333..3741902
Genome map
AA seq 189 aa AA seqDB search
MIEQLQRLPGVGPKSAQRLALHILKRPEAEVEALAQALIDAKKQVGLCQVCYHLSSEPVC
DICRNPNRDNTTICVVADSRDVIALEKTREYKGKYHVLGGVISPMDGIGPEQLTAQALVR
RVSQQQPQEVIMAISPSVEGETTTLYIGELLKPFTKVTRIAFGLPVGGDLEYADEVTLVR
ALEGRRELD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgattgaacaactgcaacgcctccccggagtgggacccaaatccgcccagcgtctagcg
ttgcatattttaaagcgcccagaggcagaagttgaagctttggcacaggcactaattgat
gcgaaaaaacaggtagggttgtgtcaagtttgctatcacctctcatctgaacctgtatgt
gatatctgccgcaatcctaaccgggataatacaactatctgtgtggttgcagattcccgt
gatgtgattgcattggaaaaaacccgcgagtataaaggtaaatatcatgtcttaggtggg
gtgatttctcccatggatggtattggacctgaacagttgacggctcaagctttggtgcgg
agagtcagtcaacaacagccacaagaagtaattatggctattagtcctagtgtagaaggg
gaaaccactactttatatataggtgagttactcaaaccttttacgaaagttacgcggatt
gcttttggtttacctgtgggtggtgatttagagtatgctgatgaggtgacactggttaga
gctttggaaggacgacgggaattagattaa

DBGET integrated database retrieval system