KEGG   Anabaena azollae 0708: Aazo_3899Help
Entry
Aazo_3899         CDS       T01260                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
naz  Anabaena azollae 0708
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aazo_3899
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_3899
   00520 Amino sugar and nucleotide sugar metabolism
    Aazo_3899
Enzymes [BR:naz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Aazo_3899
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3952457..3953164
Genome map
AA seq 235 aa AA seqDB search
MTEDNGSVRTLSVDIGGSGVKAMVLDITGKPLTERGRLETPHPATPEVVIGAIAVLAASQ
GEYHRVSVGFPGVVRCGVTETAVNLDASWLNFDLATALSEQLNKPVKVINDADMQGLGGI
KGKGVELVITLGTGFGSALFVDGKLVPNMEMGHHPFRKGETYEEQLGRAALEKIGDKKWN
KRLQKAIASLQRLFNYDFLYIGGGEAVRVNMNLPLNVKLIPNITGLLGGIALWKE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacggaagataacggttcagtacgtaccctatctgtggatattggtggtagtggtgtg
aaggcgatggttttagatatcaccggaaaaccgttaacagagaggggaaggttagaaaca
ccccatccagcaacacctgaagtagtcattggtgccattgctgtgttagctgcgtctcaa
ggggagtatcatcgggtttctgtaggttttcctggtgtggtgcggtgtggagttacagaa
acagcagtgaatttagatgctagttggctgaatttcgatttagcaacagcgttatctgaa
cagttaaataaacctgtaaaagtaattaatgatgcagatatgcaaggattagggggaata
aaaggtaaaggtgtagaattggtaattactctgggtactggttttggttcagctttgttt
gtagatggaaagttggttcccaatatggaaatgggacatcatccgttccgtaaaggggaa
acctatgaagaacaactaggacgtgctgcgttagaaaaaattggggataaaaaatggaat
aagcggttacaaaaagcgatcgcatctttgcaacgtctatttaactatgattttctttac
atcggtggtggtgaagctgtgcgcgtcaatatgaatttacccttgaacgtcaagctaatt
cctaatatcaccggcttattaggtggaattgctttgtggaaggagtga

DBGET integrated database retrieval system