KEGG   Anabaena azollae 0708: Aazo_3960Help
Entry
Aazo_3960         CDS       T01260                                 

Definition
1,4-alpha-glucan branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
naz  Anabaena azollae 0708
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Aazo_3960
Enzymes [BR:naz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Aazo_3960
Exosome [BR:naz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aazo_3960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4021581..4023872
Genome map
AA seq 763 aa AA seqDB search
MSISAIASEQVNRIVWNQHHDPFEVLGSHLIEQNGKNVWAVRAYLPNASAAWVVVPENRK
EYPMYTVHDPHFFECTIETPELSNYQLRIKEGEHELVTYDPYAFRSPHLTDFDLHLFGEG
NHHRIYEKLGAHLTEVDSVKGVYFAVWAPNARNVSVLGDFNLWDGRKHQMRKGDTGVWEL
FIPELGMGEHYKYEIKNFEGHIYEKSDPYGFQQEPRPKTASIVTDLNSYTWNDENWMEVR
RQTDPLTQAISVYEVHLGSWLHAASSEPAKLPNGETQAVVPVSELNPGARFLTYRELAER
LIPYVKELGYTHIELLPIAEHPFDGSWGYQVTGYYAPTSRFGSPEDFMYFIDQCHQNGIG
VLVDWVPGHFPKDGHGLAFFDGTYLYEHADPRKGEHKEWGTLVFNYSRNEVRNFLAANAL
FWFDKYHIDGIRVDAVASMLYNDYCRKEGEWLPNQYGGRENLEAADFLRQVNHTIFSYFP
GVLSIAEESTSWPMVSWPTYTGGLGFNLKWNMGWMHDMLDYFSMDPWFRQFHQNNITFSM
WYNHSENFMLALSHDEVVHGKSNIIGKMPGDKWQKLANVRALFAYMFAHPGKKTMFMSME
FGQWSEWNVWADLEWHLFQYEPHQQLKDFFQSLNHLYRSEPALYTQDFAREGFEWVDCSD
NRHSVVSFVRRAKDSDEFIVVVCNFTPQPHSHYRIGIPEKGFYTELFNSDARQYGGSNMG
NLGGKWTDDWSLHNRPYSLDLCLPPLGVLMLKLDKQKMAEVMK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgtccatcagcgcgatcgcctctgagcaagttaaccgtatcgtttggaatcagcatcac
gatccatttgaagtacttggttcacatctcatagaacaaaatgggaaaaatgtctgggct
gtgcgagcctacctaccaaatgccagtgccgcatgggtggtagttccagaaaacagaaaa
gaataccccatgtacacagtgcatgatccccacttttttgaatgcacaattgaaacacca
gaacttagcaactaccaattacggattaaagaaggggaacacgagcttgtcacttacgac
ccttacgccttccgttctccccatctcaccgactttgacttacatctgtttggagaaggc
aaccatcaccgcatttacgagaaactaggagcgcacttaacagaagtagatagtgtcaaa
ggtgtgtattttgctgtttgggctcctaatgcccgtaatgtttctgttctgggagatttt
aacctatgggatggacgtaaacaccaaatgaggaaaggagatacaggcgtttgggaattg
tttattcccgaactcggtatgggagagcattacaaatatgaaatcaaaaattttgaagga
catatttacgaaaaatctgatccctacggttttcagcaagaaccacgtcccaaaacagca
tctattgtcactgacttaaattcctacacttggaacgatgaaaactggatggaagtgcgg
cggcagacagacccgctcacccaagcaatttctgtctacgaagtccatttaggctcttgg
ttacacgctgccagttcagaacccgctaaattacctaatggggaaactcaagcagtcgtt
ccggtttctgaactgaatcctggggcacgctttcttacttaccgggaattagcagaaaga
ctcattccttacgtcaaagaattgggatatacccatatagaattgctgccaattgccgag
catccctttgatggttcttggggttatcaggtaactggttactatgctcccacttcccga
tttggtagccctgaagatttcatgtattttattgaccaatgtcaccaaaacggcattggt
gtactggtagattgggttcccggtcacttccccaaagatggccatggtttagcattcttt
gatggtacttatctatacgaacatgctgacccccgcaaaggtgaacataaagaatggggg
actttagtatttaactactcccgtaacgaagttagaaatttcttagcagccaatgccctc
ttctggtttgataaataccacattgacgggattcgtgtggatgctgtggcttccatgctt
tacaacgactattgccgtaaagaaggagaatggttgcccaaccagtatggtgggagagaa
aatctagaagctgcggatttcttacgtcaagtaaatcacaccatctttagttattttcct
ggtgtactttccattgctgaagaatctacttcctggcctatggtatcctggcctacctat
acaggtggtctgggctttaacctgaagtggaatatgggctggatgcatgatatgttggac
tacttcagcatggatccttggttccgccagttccatcaaaataatattactttcagtatg
tggtataaccacagcgaaaactttatgctggctctgtcccacgatgaagtggtacatggt
aagagcaatatcatcggcaaaatgcccggagataaatggcaaaagttagctaacgtgcgg
gctttatttgcctatatgtttgctcaccctggcaagaaaaccatgtttatgagtatggag
tttggccagtggagtgagtggaatgtgtgggctgatttggaatggcatttattccaatat
gaaccacaccaacagttaaaggactttttccagtctctcaaccatctttaccgttctgaa
cctgctttgtacacccaagattttgcacgggaaggatttgagtgggttgactgtagcgat
aaccgtcacagtgtagtttctttcgtccgacgtgctaaggattctgatgagtttatagtt
gtggtttgtaattttacacctcaaccacattctcactatcgcattggtatacctgaaaaa
ggattttatactgagttgttcaacagtgatgcacgtcaatatggcggtagcaatatgggc
aatttaggcggtaaatggactgatgattggtctttacataatcgtccttattccttggat
ttgtgtttaccacctttgggggttttaatgctcaagttggataaacaaaagatggctgag
gtgatgaagtaa

DBGET integrated database retrieval system