KEGG   Anabaena azollae 0708: Aazo_4577Help
Entry
Aazo_4577         CDS       T01260                                 

Definition
magnesium chelatase ATPase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
naz  Anabaena azollae 0708
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Aazo_4577
Enzymes [BR:naz01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Aazo_4577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4670826..4672832)
Genome map
AA seq 668 aa AA seqDB search
MPAPTITPTMTAFPLTAVVGQEAIKIALLLAAVDPALGGVIIAGRRGTAKSVMARAIHAL
LPPIEVVQGSVSNCDSNHPEEWDDKLLAEERHEIEREIIPAPFVQIPLGVTEDRLLGSVD
VEQSVKQGDTVFQPGLLATAHRGVLYVDEINLLDDQISNQLLTVLSDGRNQIEREGISFQ
HPCKPLFIATYNPDEGTLREHLLDRIAITLSADGVLGLDQRVQAVEQALAYSKSPQEFLQ
QYSEDIDSLKTQILLAREWLKEVTITQEQIIYLVNEAIRGGVEGHRAELFAVRVAKAAAA
LEGRNTVNAEDLRRAVELVIVPRTTIIQTPPPDQPPPPQSQDDSEEQQEDEQEEQEEQQE
EQEQQEPPDIPEEFIFDPEGVILDPTVLYFTQMAQRQGKSGSRSMIFSDDRGRYIKPMIP
KGKVKRIAVDATLRAAAPYQKARLARQPDKKVIVEQGDMRSKRLVRKAGALVVFVVDASG
SMALNRMQSAKGAVMQLLTEAYQNRDQVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPC
GGGSPLAHGLTQAVRVGINAQMGGDIGQVVIVAITDGRGNIPLARSLGEPQEPGEKPDIK
AELLDIAGRIRAAGMQLLVIDTESKFVSTGFAKELAKTAGGKYYHLPKATDKAIAAMTRG
AIADIKSR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcctactattaccccgacaatgactgcttttccgctgactgctgtggttggt
caagaggcaattaagatagctttgctgttagcagcggtagatcccgctttggggggtgtg
ataattgcaggccgtcgaggtacggctaaatctgtgatggcgcgtgctattcacgcttta
ttaccacctattgaagttgttcaaggttctgttagtaactgtgactcgaaccacccggaa
gaatgggatgataagctcttagctgaggaaagacacgagatagaaagggaaattatccct
gcacctttcgtccaaatacctcttggtgtgacggaagatcgacttttaggttctgtggat
gtggaacagtcggttaaacaaggtgatacggtttttcaaccgggtttgctggccactgct
cacaggggtgtgttgtatgtggatgaaatcaatttattagatgaccaaattagtaatcag
cttttaacggtattgtctgacggacgtaaccaaattgaacgggaagggataagttttcaa
catccttgtaagccgttgtttattgcgacttataacccagatgaagggacgctaagagaa
catttattagatagaattgcgatcacactctcagcagacggagttctgggtttagatcaa
agagtccaagcagttgaacaagcgctcgcctattctaaatctcctcaagaatttctgcaa
caatacagcgaagacatcgactcactcaaaactcaaattctccttgcacgggaatggtta
aaagaagtcaccattacccaagaacaaattatctatcttgtcaatgaagccattcgcggt
ggtgtagaaggacatcgcgcagaattatttgcagtgcgtgtagcaaaagcagcagcagca
ttagaaggacgcaacaccgtcaacgccgaagatttacgtcgtgctgtagaattggtcata
gttcccagaacaacaattattcaaaccccaccaccagaccaaccaccaccaccccaaagt
caagacgattcagaagagcagcaagaagacgaacaggaagaacaggaagaacaacaagaa
gaacaggaacagcaagaaccaccggatattcccgaagagtttatctttgatccagaagga
gtaattctcgacccaactgtgctgtattttacccaaatggcacaacgtcagggtaaatct
ggtagtcgcagtatgatcttctcagacgaccggggacgttacatcaagccgatgataccc
aaaggcaaagttaaacgcattgccgtagatgccacattaagagccgcagcgccgtatcaa
aaagcacgactagctagacaaccagacaaaaaagtcattgtcgaacaaggagatatgcgt
tctaagcgattggtaagaaaagctggtgctttagtagtatttgtggttgatgcttctggt
tcaatggctttaaatagaatgcaatctgctaaaggtgcagttatgcaactcttaaccgaa
gcctatcaaaaccgtgaccaagtatctttaatacccttccggggagaacaagcagaagtt
ttattaccccctacccgttccattgctttagccaagaatcggttagaaagattaccatgt
ggtgggggttcacctttagcacatggtttaactcaagccgtgcgtgtggggataaatgcc
caaatgggaggagatattggtcaagttgttatcgtagcaattactgatggtcgtggtaat
attcctttggctcgttctttaggtgaaccccaagaaccaggagaaaagcctgatatcaaa
gccgaattactagatattgcaggcagaatccgcgctgctggtatgcaattattggtaatt
gatacagagagtaagtttgtctctactggctttgcgaaggaattagccaaaacagccgga
ggtaaatattatcacctacccaaagcaacggataaagctattgcggctatgacgagggga
gctatagcggatataaaatcgagataa

  All links  
No link information was found.   
DBGET integrated database retrieval system