KEGG   Anabaena azollae 0708: Aazo_4577Help
Entry
Aazo_4577         CDS       T01260                                 

Definition
magnesium chelatase ATPase subunit D (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
naz  Anabaena azollae 0708
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:naz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4670826..4672832)
Genome map
AA seq 668 aa AA seqDB search
MPAPTITPTMTAFPLTAVVGQEAIKIALLLAAVDPALGGVIIAGRRGTAKSVMARAIHAL
LPPIEVVQGSVSNCDSNHPEEWDDKLLAEERHEIEREIIPAPFVQIPLGVTEDRLLGSVD
VEQSVKQGDTVFQPGLLATAHRGVLYVDEINLLDDQISNQLLTVLSDGRNQIEREGISFQ
HPCKPLFIATYNPDEGTLREHLLDRIAITLSADGVLGLDQRVQAVEQALAYSKSPQEFLQ
QYSEDIDSLKTQILLAREWLKEVTITQEQIIYLVNEAIRGGVEGHRAELFAVRVAKAAAA
LEGRNTVNAEDLRRAVELVIVPRTTIIQTPPPDQPPPPQSQDDSEEQQEDEQEEQEEQQE
EQEQQEPPDIPEEFIFDPEGVILDPTVLYFTQMAQRQGKSGSRSMIFSDDRGRYIKPMIP
KGKVKRIAVDATLRAAAPYQKARLARQPDKKVIVEQGDMRSKRLVRKAGALVVFVVDASG
SMALNRMQSAKGAVMQLLTEAYQNRDQVSLIPFRGEQAEVLLPPTRSIALAKNRLERLPC
GGGSPLAHGLTQAVRVGINAQMGGDIGQVVIVAITDGRGNIPLARSLGEPQEPGEKPDIK
AELLDIAGRIRAAGMQLLVIDTESKFVSTGFAKELAKTAGGKYYHLPKATDKAIAAMTRG
AIADIKSR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgcctactattaccccgacaatgactgcttttccgctgactgctgtggttggt
caagaggcaattaagatagctttgctgttagcagcggtagatcccgctttggggggtgtg
ataattgcaggccgtcgaggtacggctaaatctgtgatggcgcgtgctattcacgcttta
ttaccacctattgaagttgttcaaggttctgttagtaactgtgactcgaaccacccggaa
gaatgggatgataagctcttagctgaggaaagacacgagatagaaagggaaattatccct
gcacctttcgtccaaatacctcttggtgtgacggaagatcgacttttaggttctgtggat
gtggaacagtcggttaaacaaggtgatacggtttttcaaccgggtttgctggccactgct
cacaggggtgtgttgtatgtggatgaaatcaatttattagatgaccaaattagtaatcag
cttttaacggtattgtctgacggacgtaaccaaattgaacgggaagggataagttttcaa
catccttgtaagccgttgtttattgcgacttataacccagatgaagggacgctaagagaa
catttattagatagaattgcgatcacactctcagcagacggagttctgggtttagatcaa
agagtccaagcagttgaacaagcgctcgcctattctaaatctcctcaagaatttctgcaa
caatacagcgaagacatcgactcactcaaaactcaaattctccttgcacgggaatggtta
aaagaagtcaccattacccaagaacaaattatctatcttgtcaatgaagccattcgcggt
ggtgtagaaggacatcgcgcagaattatttgcagtgcgtgtagcaaaagcagcagcagca
ttagaaggacgcaacaccgtcaacgccgaagatttacgtcgtgctgtagaattggtcata
gttcccagaacaacaattattcaaaccccaccaccagaccaaccaccaccaccccaaagt
caagacgattcagaagagcagcaagaagacgaacaggaagaacaggaagaacaacaagaa
gaacaggaacagcaagaaccaccggatattcccgaagagtttatctttgatccagaagga
gtaattctcgacccaactgtgctgtattttacccaaatggcacaacgtcagggtaaatct
ggtagtcgcagtatgatcttctcagacgaccggggacgttacatcaagccgatgataccc
aaaggcaaagttaaacgcattgccgtagatgccacattaagagccgcagcgccgtatcaa
aaagcacgactagctagacaaccagacaaaaaagtcattgtcgaacaaggagatatgcgt
tctaagcgattggtaagaaaagctggtgctttagtagtatttgtggttgatgcttctggt
tcaatggctttaaatagaatgcaatctgctaaaggtgcagttatgcaactcttaaccgaa
gcctatcaaaaccgtgaccaagtatctttaatacccttccggggagaacaagcagaagtt
ttattaccccctacccgttccattgctttagccaagaatcggttagaaagattaccatgt
ggtgggggttcacctttagcacatggtttaactcaagccgtgcgtgtggggataaatgcc
caaatgggaggagatattggtcaagttgttatcgtagcaattactgatggtcgtggtaat
attcctttggctcgttctttaggtgaaccccaagaaccaggagaaaagcctgatatcaaa
gccgaattactagatattgcaggcagaatccgcgctgctggtatgcaattattggtaatt
gatacagagagtaagtttgtctctactggctttgcgaaggaattagccaaaacagccgga
ggtaaatattatcacctacccaaagcaacggataaagctattgcggctatgacgagggga
gctatagcggatataaaatcgagataa

DBGET integrated database retrieval system