KEGG   Anabaena azollae 0708: Aazo_4602Help
Entry
Aazo_4602         CDS       T01260                                 

Definition
fructose-bisphosphate aldolase (EC:4.1.2.13)
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
naz  Anabaena azollae 0708
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aazo_4602
   01230 Biosynthesis of amino acids
    Aazo_4602
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aazo_4602
   00030 Pentose phosphate pathway
    Aazo_4602
   00051 Fructose and mannose metabolism
    Aazo_4602
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Aazo_4602
   00680 Methane metabolism
    Aazo_4602
Enzymes [BR:naz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Aazo_4602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4703208..4704281)
Genome map
AA seq 357 aa AA seqDB search
MALVPMRLLLDHAAENGYGIPAFNVNNLEQIQAIMNAAAETDSPVILQASRGARNYAGEN
FLRHLILAAVETYPQIPIVMHQDHGNAPSTCYSAIKNNFTSVMMDGSLEADAKTPASFEY
NVKVTSEVVNVAHSLGVSVEGELGCLGSLETGAGEAEDGHGFEGTLDHSQLLTDPDEAVN
FVEATQVDALAVAIGTSHGAYKFTRKPTGEILAISRIEEIHRRLPNTHLVMHGSSSVPED
LIALINEFGGAIPETYGVPVEEIQKGIKSGVRKVNIDTDNRLAITAAVREALAANPKEFD
PRHFLKPSIKYMQKVCADRYEQFGTAGNASKIKQISLEDFAAKYAKGELVMRAAAKV
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgtaccaatgcggctacttttggatcacgctgctgaaaatggttatggcata
cccgcttttaacgtaaacaacttagagcagattcaagccattatgaacgcagcggctgaa
acagacagccctgtaattttacaagcttctcgcggcgcacgtaattatgcaggagaaaac
ttcctgcgccacctgattttggcagcagtagaaacctatcctcagatccccattgtcatg
caccaggatcatggtaatgctccttctacctgctattcagcaatcaaaaacaacttcacc
agcgtgatgatggatggttctttagaagctgacgctaagactcctgcaagctttgagtat
aacgttaaagttaccagcgaagttgtcaacgtagctcactctttgggtgtcagcgttgaa
ggtgaattaggctgtttaggttctctagaaaccggcgctggtgaagctgaagatggtcat
ggttttgaaggtactcttgaccactctcaacttttaactgaccctgatgaagctgttaac
ttcgtggaagcaactcaagtagacgctttagctgttgctatcggtactagccacggtgct
tacaagtttacccgtaagcctactggtgaaatcttggctatcagccgcattgaagaaatt
caccgccgcttacctaatacccacttggtaatgcacggttcttcttctgtacctgaagat
ttgattgcgctaattaacgaatttggtggtgctattcctgaaacttacggtgtacctgta
gaagaaattcaaaaaggtatcaagagtggtgtacgtaaggtaaatattgacactgataac
cgtttagctattactgcggctgtccgtgaagcattagcagctaatcccaaggaatttgac
ccccgtcacttcctcaagccttccattaaatatatgcagaaggtttgtgctgatcgctat
gagcagtttggtactgctggtaatgcaagcaagattaagcagatttctttagaagatttt
gctgctaagtatgctaaaggcgaattggtaatgagagcggctgctaaagtttaa

DBGET integrated database retrieval system