KEGG   'Nostoc azollae' 0708: Aazo_4981Help
Entry
Aazo_4981         CDS       T01260                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
naz  'Nostoc azollae' 0708
Pathway
naz00230  Purine metabolism
naz01100  Metabolic pathways
Module
naz_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:naz00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Aazo_4981
Enzymes [BR:naz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Aazo_4981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_22 AAA_18 AAA_16 MMR_HSR1 RsgA_GTPase AAA_28 NTPase_1 AAA_14 AAA_30 AAA_29 ABC_tran NACHT TsaE cobW RNA_helicase AAA_17 ATPase_2 NB-ARC AAA_5 Rad17 PduV-EutP Roc
Motif
Other DBs
NCBI-ProteinID: ADI66105
JGI: Aazo_4981
UniProt: D7DZ84
Position
complement(5100382..5100978)
Genome map
AA seq 198 aa AA seqDB search
MQVLPLPSGATTKESPSLGKLIVLTGPSGVGKGTLMQKLLQRHPELYYSVSVTTRSPRTG
EVNGKNYYFISCSKFEQLVAQGEFLEWAEFAGNYYGTPRAAVLDHIQSGQLVVLEIELEG
ARQIRASFPSALSIFILPPSSSELEKRIRGRGQDSDEAIACRLHRAQEEIQAAHEFDIQI
VNDDFDAALNEIETVLFG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttttacccttacctagtggtgctactacgaaagaaagcccgtctctgggcaag
ctgattgttttgactggccctagtggagtcggcaaaggaactttgatgcaaaagctgctt
caacgtcatccagaactgtattattcagtatctgtaacgactcgttctccccggacagga
gaagtaaacggcaaaaactattactttatcagctgcagcaagtttgaacaattagttgcg
caaggggaattcttggaatgggcagaatttgctggtaactattacggtacaccccgtgca
gcagtgcttgaccacattcagtctggtcagttggtggtgctagaaattgaactggaaggg
gcaagacaaattcgtgcttcctttcctagcgccctcagtatttttatactaccgccgtca
tcttcggaactggagaaacggatacgtggacgggggcaagattctgatgaagcgatcgct
tgccgtctgcaccgcgctcaagaggaaatacaagccgcacatgaatttgatattcaaatc
gtgaatgacgattttgacgctgctttaaacgaaattgaaacagtcctatttggataa

DBGET integrated database retrieval system