KEGG   Nocardia brasiliensis: O3I_001385Help
Entry
O3I_001385        CDS       T02270                                 

Definition
3-hydroxyacyl-CoA dehydrogenase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
nbr  Nocardia brasiliensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_001385
   01212 Fatty acid metabolism
    O3I_001385
  Carbohydrate metabolism
   00640 Propanoate metabolism
    O3I_001385
   00650 Butanoate metabolism
    O3I_001385
  Lipid metabolism
   00071 Fatty acid degradation
    O3I_001385
   01040 Biosynthesis of unsaturated fatty acids
    O3I_001385
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3I_001385
   00310 Lysine degradation
    O3I_001385
   00380 Tryptophan metabolism
    O3I_001385
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3I_001385
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O3I_001385
   00281 Geraniol degradation
    O3I_001385
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    O3I_001385
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     O3I_001385
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     O3I_001385
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     O3I_001385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
320319..322475
Genome map
AA seq 718 aa AA seqDB search
MTSTETNMIGWEQDSDGIVVLTMDDPNQGANTMNELYKSSMTATVEKLEAEKDSITGVVI
TSAKKTFFAGGDLKNMMKVGPEDGQGVMDELGTIKGALRRLETLGKPVVAAINGAALGGG
LEIALACHYRIAADVPGSQIGLPEVTLGLLPAGGGVIRTVRMLGLQNALMQVLLQGQRNK
PAKAKEIGLVNELVGTVEELVPAAKAWIKANPDKGVQPWDVKGFKIPGGTPSSPAFAANL
PAFPANLRKQIKGANMPAPRAIMSAAVEGSQVDIDNASLIESRYFVHLLTGPVAKNMIQA
FFFDLQSINNGGSRPKDVPKKDIKKIGVLGAGMMGAGIAYVSAKAGYQVVLKDVSIEAAE
RGKNYSEKIEAKALSRGKTTEEKSKALLDRITPSADAKDFDGVDFVIEAVFENTELKHKV
FQEIEDIVTPDALLGSNTSTLPITGLAKGVKREEDFIGIHFFSPVDKMPLVEIIKGEKTS
PEALARVFDYTLAIKKTPIVVNDSRGFFTSRVIGTFVNEAIAMLTEGIEPATIEQAGLQA
GYPAAPLQLSDELNMKLMQKIAKETIEAAEHGDTTMGKKRHPAQDVIDYMVGESRPGRLE
KAGFYEYDENGKRTGLWPGLREHFKTTADFTVPLQDLIDRMLFAEAIETQKCFDEGVLET
TADANIGSIFGIGFPAWTGGVHQFIVGYPGGQAAFVERADYLAKTYGERFEVPASLRK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccgaaaccaacatgatcggttgggagcaggattcggacggcatcgtcgta
ctgacgatggacgacccgaaccagggcgccaacacgatgaacgagctgtacaagtcgtcg
atgaccgcgaccgtcgagaagctcgaagccgagaaggacagcatcaccggcgtggtgatc
acctcggctaagaagaccttcttcgcgggcggcgacctcaagaacatgatgaaggtcggc
ccggaagacggccagggcgtcatggacgagctcggcaccatcaagggcgcgctgcggcgc
ctggagaccctgggcaagccggtcgtcgccgccatcaacggcgcggcgctcggcggcggc
ctggagatcgcgctggcctgtcactaccggatcgcggccgacgtgccgggttcacagatc
ggcctgcccgaggtcaccctgggcctgctgcccgccggtggcggcgtgatccgcaccgtg
cgcatgctcggtctgcagaacgccctgatgcaggtgctgctgcagggccagcgcaacaag
ccggccaaggccaaggagatcggcctggtcaacgagctcgtcggcaccgtcgaagagctg
gttccggccgccaaggcgtggatcaaggcgaacccggacaagggcgtacagccctgggac
gtcaagggtttcaagatccccggcggcaccccgtccagcccggccttcgcggccaacctg
cccgccttcccggcgaacctgcgcaagcagatcaagggcgcgaacatgcccgccccgcgg
gcgatcatgtccgccgcggtcgagggttcgcaggtcgacatcgacaacgcgtcgctcatc
gagtcgcgctacttcgtgcacctgctcaccggcccggtcgcgaagaacatgatccaggcg
ttcttcttcgacctgcagtccatcaacaacggtggctcgcggccgaaggatgtgccgaag
aaggacatcaagaagatcggtgtgctcggcgcgggcatgatgggcgcgggcatcgcctac
gtctccgccaaggcgggctaccaggtcgtgctcaaggacgtcagcatcgaggcggccgag
cgcggcaagaactactccgagaagatcgaggccaaggccctctcccgcggtaagaccacg
gaggagaagtccaaggcgctgctcgaccggatcaccccgtccgccgacgccaaggacttc
gacggcgtggacttcgtgatcgaggccgtcttcgagaacaccgagctcaagcacaaggtg
ttccaggagatcgaggacatcgtcacccccgacgcgctgctcggctcgaacacctcgacc
ctgccgatcaccggcctggccaagggcgtcaagcgcgaagaggacttcatcggtatccac
ttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggtgagaagacctcg
cccgaggcgctggcccgggtgttcgactacaccctcgcgatcaagaagaccccgatcgtg
gtgaacgacagccgcggcttcttcacctcgcgcgtgatcggcaccttcgtcaacgaggcg
atcgccatgctcaccgagggcatcgagcccgcgaccatcgagcaggccggtctgcaggcg
ggctacccggccgcgccgctgcagctgtcggatgagctgaacatgaagctcatgcagaag
atcgccaaggagaccatcgaggccgccgagcacggcgacaccacgatgggcaagaagcgg
catccggcgcaggacgtcatcgactacatggtcggcgaaagtcgtccgggtcgcctggag
aaggcgggcttctacgagtacgacgagaacggcaagcgcaccggtctgtggccgggcctg
cgtgagcacttcaagaccacggcggacttcaccgttccgctgcaggatctgatcgaccgc
atgctgttcgcggaggcgatcgagacccagaagtgcttcgacgagggcgtgctggagacc
accgccgacgcgaacatcggctcgatcttcggcatcggcttcccggcctggaccggtggc
gtgcaccagttcatcgtcggctacccgggtggccaggcggcgttcgtcgagcgcgccgac
tacctcgccaagacctacggcgagcgtttcgaggttccggcctcgctgcgcaagtag

DBGET integrated database retrieval system