KEGG   Nocardia brasiliensis: O3I_001385Help
Entry
O3I_001385        CDS       T02270                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00071  Fatty acid degradation
nbr00280  Valine, leucine and isoleucine degradation
nbr00281  Geraniol degradation
nbr00310  Lysine degradation
nbr00362  Benzoate degradation
nbr00380  Tryptophan metabolism
nbr00410  beta-Alanine metabolism
nbr00640  Propanoate metabolism
nbr00650  Butanoate metabolism
nbr00903  Limonene and pinene degradation
nbr00930  Caprolactam degradation
nbr01040  Biosynthesis of unsaturated fatty acids
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
nbr01120  Microbial metabolism in diverse environments
nbr01130  Biosynthesis of antibiotics
nbr01200  Carbon metabolism
nbr01212  Fatty acid metabolism
Module
nbr_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    O3I_001385
   00650 Butanoate metabolism
    O3I_001385
  Lipid metabolism
   00071 Fatty acid degradation
    O3I_001385
   01040 Biosynthesis of unsaturated fatty acids
    O3I_001385
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    O3I_001385
   00310 Lysine degradation
    O3I_001385
   00380 Tryptophan metabolism
    O3I_001385
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    O3I_001385
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    O3I_001385
   00281 Geraniol degradation
    O3I_001385
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3I_001385
   00930 Caprolactam degradation
    O3I_001385
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     O3I_001385
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     O3I_001385
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     O3I_001385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 F420_oxidored adh_short_C2 AlaDh_PNT_C PALP NAD_Gly3P_dh_N NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AFT98239
UniProt: K0EMV3
Position
320319..322475
Genome map
AA seq 718 aa AA seqDB search
MTSTETNMIGWEQDSDGIVVLTMDDPNQGANTMNELYKSSMTATVEKLEAEKDSITGVVI
TSAKKTFFAGGDLKNMMKVGPEDGQGVMDELGTIKGALRRLETLGKPVVAAINGAALGGG
LEIALACHYRIAADVPGSQIGLPEVTLGLLPAGGGVIRTVRMLGLQNALMQVLLQGQRNK
PAKAKEIGLVNELVGTVEELVPAAKAWIKANPDKGVQPWDVKGFKIPGGTPSSPAFAANL
PAFPANLRKQIKGANMPAPRAIMSAAVEGSQVDIDNASLIESRYFVHLLTGPVAKNMIQA
FFFDLQSINNGGSRPKDVPKKDIKKIGVLGAGMMGAGIAYVSAKAGYQVVLKDVSIEAAE
RGKNYSEKIEAKALSRGKTTEEKSKALLDRITPSADAKDFDGVDFVIEAVFENTELKHKV
FQEIEDIVTPDALLGSNTSTLPITGLAKGVKREEDFIGIHFFSPVDKMPLVEIIKGEKTS
PEALARVFDYTLAIKKTPIVVNDSRGFFTSRVIGTFVNEAIAMLTEGIEPATIEQAGLQA
GYPAAPLQLSDELNMKLMQKIAKETIEAAEHGDTTMGKKRHPAQDVIDYMVGESRPGRLE
KAGFYEYDENGKRTGLWPGLREHFKTTADFTVPLQDLIDRMLFAEAIETQKCFDEGVLET
TADANIGSIFGIGFPAWTGGVHQFIVGYPGGQAAFVERADYLAKTYGERFEVPASLRK
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
gtgaccagcaccgaaaccaacatgatcggttgggagcaggattcggacggcatcgtcgta
ctgacgatggacgacccgaaccagggcgccaacacgatgaacgagctgtacaagtcgtcg
atgaccgcgaccgtcgagaagctcgaagccgagaaggacagcatcaccggcgtggtgatc
acctcggctaagaagaccttcttcgcgggcggcgacctcaagaacatgatgaaggtcggc
ccggaagacggccagggcgtcatggacgagctcggcaccatcaagggcgcgctgcggcgc
ctggagaccctgggcaagccggtcgtcgccgccatcaacggcgcggcgctcggcggcggc
ctggagatcgcgctggcctgtcactaccggatcgcggccgacgtgccgggttcacagatc
ggcctgcccgaggtcaccctgggcctgctgcccgccggtggcggcgtgatccgcaccgtg
cgcatgctcggtctgcagaacgccctgatgcaggtgctgctgcagggccagcgcaacaag
ccggccaaggccaaggagatcggcctggtcaacgagctcgtcggcaccgtcgaagagctg
gttccggccgccaaggcgtggatcaaggcgaacccggacaagggcgtacagccctgggac
gtcaagggtttcaagatccccggcggcaccccgtccagcccggccttcgcggccaacctg
cccgccttcccggcgaacctgcgcaagcagatcaagggcgcgaacatgcccgccccgcgg
gcgatcatgtccgccgcggtcgagggttcgcaggtcgacatcgacaacgcgtcgctcatc
gagtcgcgctacttcgtgcacctgctcaccggcccggtcgcgaagaacatgatccaggcg
ttcttcttcgacctgcagtccatcaacaacggtggctcgcggccgaaggatgtgccgaag
aaggacatcaagaagatcggtgtgctcggcgcgggcatgatgggcgcgggcatcgcctac
gtctccgccaaggcgggctaccaggtcgtgctcaaggacgtcagcatcgaggcggccgag
cgcggcaagaactactccgagaagatcgaggccaaggccctctcccgcggtaagaccacg
gaggagaagtccaaggcgctgctcgaccggatcaccccgtccgccgacgccaaggacttc
gacggcgtggacttcgtgatcgaggccgtcttcgagaacaccgagctcaagcacaaggtg
ttccaggagatcgaggacatcgtcacccccgacgcgctgctcggctcgaacacctcgacc
ctgccgatcaccggcctggccaagggcgtcaagcgcgaagaggacttcatcggtatccac
ttcttctcgccggtcgacaagatgccgctggtggagatcatcaagggtgagaagacctcg
cccgaggcgctggcccgggtgttcgactacaccctcgcgatcaagaagaccccgatcgtg
gtgaacgacagccgcggcttcttcacctcgcgcgtgatcggcaccttcgtcaacgaggcg
atcgccatgctcaccgagggcatcgagcccgcgaccatcgagcaggccggtctgcaggcg
ggctacccggccgcgccgctgcagctgtcggatgagctgaacatgaagctcatgcagaag
atcgccaaggagaccatcgaggccgccgagcacggcgacaccacgatgggcaagaagcgg
catccggcgcaggacgtcatcgactacatggtcggcgaaagtcgtccgggtcgcctggag
aaggcgggcttctacgagtacgacgagaacggcaagcgcaccggtctgtggccgggcctg
cgtgagcacttcaagaccacggcggacttcaccgttccgctgcaggatctgatcgaccgc
atgctgttcgcggaggcgatcgagacccagaagtgcttcgacgagggcgtgctggagacc
accgccgacgcgaacatcggctcgatcttcggcatcggcttcccggcctggaccggtggc
gtgcaccagttcatcgtcggctacccgggtggccaggcggcgttcgtcgagcgcgccgac
tacctcgccaagacctacggcgagcgtttcgaggttccggcctcgctgcgcaagtag

DBGET integrated database retrieval system