KEGG   Nocardia brasiliensis: O3I_001435Help
Entry
O3I_001435        CDS       T02270                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nbr  Nocardia brasiliensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nbr03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
333568..334176
Genome map
AA seq 202 aa AA seqDB search
MYEGPVQDLIDELGKLPGVGPKSAQRIAFHLLQVEPPEIDRLQAALQKVRDGVQFCVSCG
TVSDGELCRICADPRRDRTMICVVEEPKDVQAIERTREFRGRYHVLGGALDPLSGIGPDQ
LRIRELLARIGNQQDGVDVSEVIIATDPNTEGEATATYLVRMLRDFPGLSVTRLASGLPM
GGDLEFADELTLGRALSGRRAL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
ttgtacgagggtccggttcaggatctgatcgacgagctgggcaagctgcccggtgtcggt
ccgaagagcgcgcagcgcatcgcttttcatctgttgcaggtggagccgccggagatcgac
cggctacaggccgccctgcagaaggtgcgcgacggcgtgcagttctgcgtgtcctgcggc
accgtctccgacggcgaactgtgccgcatctgcgccgacccgcggcgcgaccgcaccatg
atctgtgtggtcgaggagccgaaagacgtgcaggccatcgagcgcacccgggagttccgt
gggcggtaccacgtgctcggcggtgcgctcgacccgctcagcggcatcgggcccgaccag
ctgcgcatccgggaactgctggcgcgcatcggaaaccagcaggacggcgtggacgtcagc
gaggtgatcatcgcgaccgacccgaacaccgagggcgaggcgacggccacctacctggtg
cgcatgctgcgcgacttccccgggctcagcgtgaccaggctggcctcgggtctgccgatg
ggcggcgacctggaattcgcggacgagctgaccctggggcgcgcgctgtcgggacgccgc
gcgctctag

DBGET integrated database retrieval system