KEGG   Nocardia brasiliensis: O3I_001555Help
Entry
O3I_001555        CDS       T02270                                 

Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00984  Steroid degradation
nbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    O3I_001555
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     O3I_001555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C NAD_binding_8 Pyr_redox_2 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFT98273
UniProt: K0EMV7
Position
363779..365407
Genome map
AA seq 542 aa AA seqDB search
MRRRAFFKAAGAAALLGAAAGSASSLTAGVGSADPVWNLLFQAWVPEIFAPLPDPPEHSP
AIVIGSGFGAAVTALRLAEAGIANTVLERGSRWPNDPWREIFTGDDLPDGRGFWHRTSFT
GVSKVPVHFASFGGVLDCTSYPGIDVWRAAAVGGGSVIFTGAMVAPERRFFDHVFGGTVD
YGELDRVYYPRVREMLRLNTMPPDIYGSTPFTHSRAWDDQVRKAGYQPLPNDSIFNWDIL
RAELGGGSRPSGTAARSNLGNSNGAKFDLNQNYLRYAQGTGRSAIFPGHQVESIAQEPGG
RYSLIVSKLAPTGEVLGTRTLTCDQLFLGAGSVGTSELLVRAQATGTLPNLNEHIGDGWG
TNGDVVLGRGASALAGLGQGVPSASRIFDESGAPLTLESWYIPGIPFETGALASLGMVLD
GTRARFGYDRAANRVGLSWPAANRAEMVAAARAVDHRIAERADAVLEYGALGYDANALFT
AHPLGGAVLGRATDGYGRVHGHPGLYVMDGAAIPGSTGTVNPSLTIAALAERNIEAIIRQ
GK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtagacgcgccttcttcaaagctgcgggtgcagccgccctgctgggcgctgccgcg
ggttcggcttcgtcgctgacggccggtgtggggtccgcggaccccgtctggaatctgctg
ttccaggcctgggtgccggaaatctttgccccgctgcccgatccgcccgagcattcgccc
gcgatcgtgatcggctccggcttcggcgccgcggtcaccgcgttgcggctggccgaggcc
ggtatcgccaacacggtgctcgaacgcggctcgcgctggcccaatgatccctggcgggag
atcttcaccggcgacgacctgcccgacggccgtggcttctggcatcgcaccagcttcacc
ggcgtctccaaggtgccggtgcatttcgcgagcttcggcggcgtgctcgactgcaccagc
taccccggcatcgatgtctggcgggcggcggcggtcggtggcggctcggtgatcttcacc
ggcgcgatggtcgccccggagcgccgcttcttcgaccacgtgttcggcggcaccgtcgac
tacggcgagctggaccgcgtctactacccccgggtgcgagagatgttgcggctgaacacg
atgccgccggacatctacggttcgacgccgttcacgcactcccgggcctgggacgatcag
gtgcgcaaagccggctatcagccactgcccaacgactcgatcttcaactgggacatcctg
cgcgccgaactcggcggcggctcccgtccgtcgggcaccgcggcgcgcagcaacctgggc
aactccaacggcgcgaagttcgacctgaaccagaattatctgcgctacgcccagggcacc
ggccgatccgcgatcttccccggccatcaggtggaatcgatcgcccaggagccgggcggc
cgatactccctgatcgtctcgaagctcgcgccgaccggggaggtgctcggcacccgcacc
ctcacctgcgatcagctgttcctcggcgccggctcggtcggcacctcggaactgctggtc
cgcgcgcaggccaccggcaccctgcccaacctcaacgagcacatcggcgacggctggggc
accaacggtgacgtggtgctcggccggggcgcgagcgcgctggccgggctcgggcagggc
gtgccgagtgcgagccggatcttcgacgaatcgggggcgccgctcaccctggagagctgg
tacatccccggcatcccattcgagacgggcgcgctcgcctcgctgggcatggtgctcgac
gggacgcgcgcgcggttcggttacgaccgcgcggcgaaccgggtcggcttgagctggccc
gcggcgaaccgcgcggagatggtcgcggccgcccgcgcggtcgatcaccggatcgccgaa
agggccgacgccgtcctggaatacggcgcgctcggctacgacgccaacgccctgttcacc
gcgcatccgctgggcggggcggtgctcggccgggccaccgacggctacggccgggtgcac
ggccatcccggtctgtacgtgatggacggcgccgcgatcccgggcagcaccggcacggtg
aacccgtcgctcaccatcgcggcgctcgccgaacgcaatatcgaggcgatcatccgccag
gggaagtag

DBGET integrated database retrieval system