KEGG   Nocardia brasiliensis: O3I_001555Help
Entry
O3I_001555        CDS       T02270                                 

Definition
putative cholesterol oxidase
Orthology
K03333  
cholesterol oxidase [EC:1.1.3.6]
Organism
nbr  Nocardia brasiliensis
Pathway
Steroid degradation
Class
Metabolism; Xenobiotics biodegradation and metabolism; Steroid degradation [PATH:nbr00984]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363779..365407
Genome map
AA seq 542 aa AA seqDB search
MRRRAFFKAAGAAALLGAAAGSASSLTAGVGSADPVWNLLFQAWVPEIFAPLPDPPEHSP
AIVIGSGFGAAVTALRLAEAGIANTVLERGSRWPNDPWREIFTGDDLPDGRGFWHRTSFT
GVSKVPVHFASFGGVLDCTSYPGIDVWRAAAVGGGSVIFTGAMVAPERRFFDHVFGGTVD
YGELDRVYYPRVREMLRLNTMPPDIYGSTPFTHSRAWDDQVRKAGYQPLPNDSIFNWDIL
RAELGGGSRPSGTAARSNLGNSNGAKFDLNQNYLRYAQGTGRSAIFPGHQVESIAQEPGG
RYSLIVSKLAPTGEVLGTRTLTCDQLFLGAGSVGTSELLVRAQATGTLPNLNEHIGDGWG
TNGDVVLGRGASALAGLGQGVPSASRIFDESGAPLTLESWYIPGIPFETGALASLGMVLD
GTRARFGYDRAANRVGLSWPAANRAEMVAAARAVDHRIAERADAVLEYGALGYDANALFT
AHPLGGAVLGRATDGYGRVHGHPGLYVMDGAAIPGSTGTVNPSLTIAALAERNIEAIIRQ
GK
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtagacgcgccttcttcaaagctgcgggtgcagccgccctgctgggcgctgccgcg
ggttcggcttcgtcgctgacggccggtgtggggtccgcggaccccgtctggaatctgctg
ttccaggcctgggtgccggaaatctttgccccgctgcccgatccgcccgagcattcgccc
gcgatcgtgatcggctccggcttcggcgccgcggtcaccgcgttgcggctggccgaggcc
ggtatcgccaacacggtgctcgaacgcggctcgcgctggcccaatgatccctggcgggag
atcttcaccggcgacgacctgcccgacggccgtggcttctggcatcgcaccagcttcacc
ggcgtctccaaggtgccggtgcatttcgcgagcttcggcggcgtgctcgactgcaccagc
taccccggcatcgatgtctggcgggcggcggcggtcggtggcggctcggtgatcttcacc
ggcgcgatggtcgccccggagcgccgcttcttcgaccacgtgttcggcggcaccgtcgac
tacggcgagctggaccgcgtctactacccccgggtgcgagagatgttgcggctgaacacg
atgccgccggacatctacggttcgacgccgttcacgcactcccgggcctgggacgatcag
gtgcgcaaagccggctatcagccactgcccaacgactcgatcttcaactgggacatcctg
cgcgccgaactcggcggcggctcccgtccgtcgggcaccgcggcgcgcagcaacctgggc
aactccaacggcgcgaagttcgacctgaaccagaattatctgcgctacgcccagggcacc
ggccgatccgcgatcttccccggccatcaggtggaatcgatcgcccaggagccgggcggc
cgatactccctgatcgtctcgaagctcgcgccgaccggggaggtgctcggcacccgcacc
ctcacctgcgatcagctgttcctcggcgccggctcggtcggcacctcggaactgctggtc
cgcgcgcaggccaccggcaccctgcccaacctcaacgagcacatcggcgacggctggggc
accaacggtgacgtggtgctcggccggggcgcgagcgcgctggccgggctcgggcagggc
gtgccgagtgcgagccggatcttcgacgaatcgggggcgccgctcaccctggagagctgg
tacatccccggcatcccattcgagacgggcgcgctcgcctcgctgggcatggtgctcgac
gggacgcgcgcgcggttcggttacgaccgcgcggcgaaccgggtcggcttgagctggccc
gcggcgaaccgcgcggagatggtcgcggccgcccgcgcggtcgatcaccggatcgccgaa
agggccgacgccgtcctggaatacggcgcgctcggctacgacgccaacgccctgttcacc
gcgcatccgctgggcggggcggtgctcggccgggccaccgacggctacggccgggtgcac
ggccatcccggtctgtacgtgatggacggcgccgcgatcccgggcagcaccggcacggtg
aacccgtcgctcaccatcgcggcgctcgccgaacgcaatatcgaggcgatcatccgccag
gggaagtag

DBGET integrated database retrieval system