KEGG   Nocardia brasiliensis: O3I_002625Help
Entry
O3I_002625        CDS       T02270                                 

Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00360  Phenylalanine metabolism
nbr00362  Benzoate degradation
nbr00620  Pyruvate metabolism
nbr00621  Dioxin degradation
nbr00622  Xylene degradation
nbr00650  Butanoate metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
nbr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3I_002625
   00650 Butanoate metabolism
    O3I_002625
  Amino acid metabolism
   00360 Phenylalanine metabolism
    O3I_002625
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3I_002625
   00622 Xylene degradation
    O3I_002625
   00621 Dioxin degradation
    O3I_002625
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     O3I_002625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: AFT98487
UniProt: K0EGT9
Position
594065..594976
Genome map
AA seq 303 aa AA seqDB search
MSETGTVTAAIVGSGNISTDLLYKLLRSTTIEPRWMIGIDPDSEGLKRARGLGLETSAEG
VDWLLGQSELPELIFEATSAYVHRAAAPRYAEAGIRAVDLTPAAVGPAVVPPVNLGANLD
APNVNMITCGGQATIPIVAAVSRVVPVPYAEIVASVSSVSAGPGTRANIDEFTKTTSRGV
ETIGGAQRGKAIIILNPAEPPMIMRDTIFCAIPEDADTDAITESIQRMVADIQQYVPGYR
LLNDPQFDPPSVISGGMAKVSVFVEVEGAGDFLPPYAGNLDIMTAAATRVGEVLAGQVRA
ARV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgagactgggaccgtcaccgccgcgatcgtcgggtccggcaacatcagtaccgat
ctgctctacaaactgctgcgctcgaccaccatcgagccgcggtggatgatcgggatcgac
ccggacagtgagggattgaagcgggccagggggctcggcctggaaacctcggccgaaggc
gtggactggctgctcgggcagtccgagctgcccgagctgatcttcgaggccacctccgcg
tacgtgcatcgcgccgccgccccgcgctacgccgaggcgggtatccgcgcggtcgatctc
accccggccgccgtcggccccgccgtggtgccgccggtgaacctcggcgcgaatctggac
gcgccgaacgtcaacatgatcacctgcggtggccaggccaccattccgatcgtcgcggcc
gtctcccgggtcgtgccggtgccctacgccgagatcgtcgcgtccgtgtcctcggtgtcc
gcgggccccggcacccgggccaatatcgacgagttcaccaagaccaccagtcgtggggtc
gagaccatcggcggcgcgcagcgcggcaaggccatcatcatcctgaatccggcggagccg
ccgatgatcatgcgcgacaccatcttctgcgccatccccgaggatgccgacaccgacgcg
atcaccgagtcgatccagcgcatggtcgccgacatccagcagtacgtgcccgggtaccgg
ctgctcaacgaccctcagttcgatccgccgtcggtgatttccggtggcatggcgaaggtt
tcggtattcgtcgaggtcgaaggcgcgggtgacttcctgcccccgtacgcgggcaacctc
gacatcatgaccgccgccgcgaccagggtcggcgaggtactcgccggtcaagtccgcgcg
gcccgggtgtaa

DBGET integrated database retrieval system