KEGG   Nocardia brasiliensis: O3I_002625Help
Entry
O3I_002625        CDS       T02270                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
nbr  Nocardia brasiliensis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    O3I_002625
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3I_002625
   00650 Butanoate metabolism
    O3I_002625
  Amino acid metabolism
   00360 Phenylalanine metabolism
    O3I_002625
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    O3I_002625
   00622 Xylene degradation
    O3I_002625
   00621 Dioxin degradation
    O3I_002625
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     O3I_002625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
594065..594976
Genome map
AA seq 303 aa AA seqDB search
MSETGTVTAAIVGSGNISTDLLYKLLRSTTIEPRWMIGIDPDSEGLKRARGLGLETSAEG
VDWLLGQSELPELIFEATSAYVHRAAAPRYAEAGIRAVDLTPAAVGPAVVPPVNLGANLD
APNVNMITCGGQATIPIVAAVSRVVPVPYAEIVASVSSVSAGPGTRANIDEFTKTTSRGV
ETIGGAQRGKAIIILNPAEPPMIMRDTIFCAIPEDADTDAITESIQRMVADIQQYVPGYR
LLNDPQFDPPSVISGGMAKVSVFVEVEGAGDFLPPYAGNLDIMTAAATRVGEVLAGQVRA
ARV
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgagactgggaccgtcaccgccgcgatcgtcgggtccggcaacatcagtaccgat
ctgctctacaaactgctgcgctcgaccaccatcgagccgcggtggatgatcgggatcgac
ccggacagtgagggattgaagcgggccagggggctcggcctggaaacctcggccgaaggc
gtggactggctgctcgggcagtccgagctgcccgagctgatcttcgaggccacctccgcg
tacgtgcatcgcgccgccgccccgcgctacgccgaggcgggtatccgcgcggtcgatctc
accccggccgccgtcggccccgccgtggtgccgccggtgaacctcggcgcgaatctggac
gcgccgaacgtcaacatgatcacctgcggtggccaggccaccattccgatcgtcgcggcc
gtctcccgggtcgtgccggtgccctacgccgagatcgtcgcgtccgtgtcctcggtgtcc
gcgggccccggcacccgggccaatatcgacgagttcaccaagaccaccagtcgtggggtc
gagaccatcggcggcgcgcagcgcggcaaggccatcatcatcctgaatccggcggagccg
ccgatgatcatgcgcgacaccatcttctgcgccatccccgaggatgccgacaccgacgcg
atcaccgagtcgatccagcgcatggtcgccgacatccagcagtacgtgcccgggtaccgg
ctgctcaacgaccctcagttcgatccgccgtcggtgatttccggtggcatggcgaaggtt
tcggtattcgtcgaggtcgaaggcgcgggtgacttcctgcccccgtacgcgggcaacctc
gacatcatgaccgccgccgcgaccagggtcggcgaggtactcgccggtcaagtccgcgcg
gcccgggtgtaa

DBGET integrated database retrieval system