KEGG   Nocardia brasiliensis: O3I_005390Help
Entry
O3I_005390        CDS       T02270                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nbr  Nocardia brasiliensis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_005390
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_005390
   00650 Butanoate metabolism
    O3I_005390
  Energy metabolism
   00190 Oxidative phosphorylation
    O3I_005390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1257154..1257585)
Genome map
AA seq 143 aa AA seqDB search
MSAPVLGKSYDRPASLDSPRSPRARSKNNFEMYAWVFMRFSGLLLIVLVLGHMTIMLLLD
GGVKRLNFGFVAGRWASPFWQIWDLTMLWLAQLHGGNGLRTVIADYSRKDSTRFWLNTLL
AISMILILAVGTYVIFTFDPNIS
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcacctgttctgggtaagtcctacgaccggccggccagcctggattcgccgcgc
tcgccccgcgcccgctcgaagaacaacttcgagatgtacgcctgggtgttcatgcgcttc
tccggcctgctgctgatcgtgctcgtgctcggccacatgacgatcatgctgctactcgac
ggcggcgtgaagcggctcaacttcggcttcgtcgccggccgctgggccagcccgttctgg
cagatctgggacctgaccatgctctggctcgcccagctgcacggcggcaacggcctgcgc
acggtgatcgcggactactcccgcaaggactcgactcggttctggctgaacaccctgctg
gccatctcgatgattctgatcctggccgtcggcacgtacgtcatcttcaccttcgacccc
aacatcagttag

  All links  
No link information was found.   
DBGET integrated database retrieval system