KEGG   Nocardia brasiliensis: O3I_005410Help
Entry
O3I_005410        CDS       T02270                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00240  Pyrimidine metabolism
nbr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    O3I_005410 (deoA)
Enzymes [BR:nbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     O3I_005410 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl DUF2254 PTS_EIIA_1 TMP_2
Motif
Other DBs
NCBI-ProteinID: AFT99044
UniProt: K0EQD7
Position
1259040..1260329
Genome map
AA seq 429 aa AA seqDB search
MTALDAVSIITAKRDGGALSDAQIDWVIDGFTKGVVADEQMSALAMAIVWRGMTRRETAR
WTAAMIASGRRMDFTDLPRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHT
GGTLDKLEAIPGWQADVSVPRMRELLSDPAVGAVVCAAGADLAPADKRLYALRDVTGTVE
SIPLIASSIMSKKIAEGTAALVLDVKVGAGAFLKTLDGARELATAMVELGTDAGVRTVAL
LTAMDTPLGRTAGNALEVAESVEVLAGGGPADIVELTVTLAREMVALAGLDIDPADVLAD
GRAMDHWRAMIRAQGGDPDAALPTAKHTEVVKAERDGVLTRLDAMGVGIAAWRLGAGRAR
QGDPVQFGAGVEMHVKPGDSVTAGQPLLTLHTDTPDAFAGAQDALREAVAIGDTGEKPTA
PLLLGRIGV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcactggacgcggtttcgatcatcactgccaagcgtgacggcggcgcgctgtcg
gacgcccagatcgactgggtgatcgacgggttcaccaagggggtggtggccgacgagcag
atgtcggccctggccatggcgatcgtgtggcgggggatgacccggcgggagaccgcgcgc
tggaccgccgcgatgatcgcgtccggccgccggatggacttcaccgatctgccccggccc
acggtggacaagcattcgaccggcggggtgggcgacaagatcacgctgccgttggcgccg
ctggtcgccgcgtgcggcgccgccgtcccgcagctgtccgggcgcgggctcggccacacc
ggcggcacgctcgacaagctcgaagccattcccggctggcaggccgacgtttcggtgccg
cgaatgcgcgagttgctcagcgaccccgcggtcggcgcggtggtgtgtgcggcgggcgcc
gacctcgcaccggcggacaaacggctctacgcgctgcgcgatgtcaccggcaccgtggaa
tccatcccgttgatcgccagctcgatcatgagcaagaagatcgcggagggcaccgcggcc
ctggtgctcgacgtgaaggtcggcgcgggcgcgttcctgaagacgctcgacggcgcgcgc
gaattggccacggccatggtcgaattgggcaccgacgcgggcgtgcgcacggtggcgctg
ctcaccgcgatggacaccccgctcggccggacggcgggtaacgcgctggaggtggccgag
tcggtggaggtgctcgccgggggcgggcccgcggatatcgtcgagctcaccgtcacgctc
gcgcgcgagatggtcgcactggccgggctcgacatcgacccggccgacgtgctggccgac
ggccgggcgatggatcactggcgcgcgatgatccgggcgcagggcggcgacccggatgcc
gcgctgcccaccgcgaaacacaccgaggtcgtcaaggccgagcgtgacggcgtgctcacc
cggctggacgccatgggcgtcggcatcgcggcgtggcggctcggcgcgggccgggccagg
cagggcgatccggtgcagttcggcgcgggcgtcgaaatgcatgtcaagccaggtgattcc
gtcaccgccgggcagccgttgctcaccctgcacaccgacaccccggacgcgttcgccggt
gcgcaggacgcgctgcgagaggctgtcgccatcggcgacaccggcgagaagcccaccgcc
cctttgctcctcggtcgaatcggggtctga

DBGET integrated database retrieval system