KEGG   Nocardia brasiliensis: O3I_005410Help
Entry
O3I_005410        CDS       T02270                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
nbr  Nocardia brasiliensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:nbr00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1259040..1260329
Genome map
AA seq 429 aa AA seqDB search
MTALDAVSIITAKRDGGALSDAQIDWVIDGFTKGVVADEQMSALAMAIVWRGMTRRETAR
WTAAMIASGRRMDFTDLPRPTVDKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHT
GGTLDKLEAIPGWQADVSVPRMRELLSDPAVGAVVCAAGADLAPADKRLYALRDVTGTVE
SIPLIASSIMSKKIAEGTAALVLDVKVGAGAFLKTLDGARELATAMVELGTDAGVRTVAL
LTAMDTPLGRTAGNALEVAESVEVLAGGGPADIVELTVTLAREMVALAGLDIDPADVLAD
GRAMDHWRAMIRAQGGDPDAALPTAKHTEVVKAERDGVLTRLDAMGVGIAAWRLGAGRAR
QGDPVQFGAGVEMHVKPGDSVTAGQPLLTLHTDTPDAFAGAQDALREAVAIGDTGEKPTA
PLLLGRIGV
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgacggcactggacgcggtttcgatcatcactgccaagcgtgacggcggcgcgctgtcg
gacgcccagatcgactgggtgatcgacgggttcaccaagggggtggtggccgacgagcag
atgtcggccctggccatggcgatcgtgtggcgggggatgacccggcgggagaccgcgcgc
tggaccgccgcgatgatcgcgtccggccgccggatggacttcaccgatctgccccggccc
acggtggacaagcattcgaccggcggggtgggcgacaagatcacgctgccgttggcgccg
ctggtcgccgcgtgcggcgccgccgtcccgcagctgtccgggcgcgggctcggccacacc
ggcggcacgctcgacaagctcgaagccattcccggctggcaggccgacgtttcggtgccg
cgaatgcgcgagttgctcagcgaccccgcggtcggcgcggtggtgtgtgcggcgggcgcc
gacctcgcaccggcggacaaacggctctacgcgctgcgcgatgtcaccggcaccgtggaa
tccatcccgttgatcgccagctcgatcatgagcaagaagatcgcggagggcaccgcggcc
ctggtgctcgacgtgaaggtcggcgcgggcgcgttcctgaagacgctcgacggcgcgcgc
gaattggccacggccatggtcgaattgggcaccgacgcgggcgtgcgcacggtggcgctg
ctcaccgcgatggacaccccgctcggccggacggcgggtaacgcgctggaggtggccgag
tcggtggaggtgctcgccgggggcgggcccgcggatatcgtcgagctcaccgtcacgctc
gcgcgcgagatggtcgcactggccgggctcgacatcgacccggccgacgtgctggccgac
ggccgggcgatggatcactggcgcgcgatgatccgggcgcagggcggcgacccggatgcc
gcgctgcccaccgcgaaacacaccgaggtcgtcaaggccgagcgtgacggcgtgctcacc
cggctggacgccatgggcgtcggcatcgcggcgtggcggctcggcgcgggccgggccagg
cagggcgatccggtgcagttcggcgcgggcgtcgaaatgcatgtcaagccaggtgattcc
gtcaccgccgggcagccgttgctcaccctgcacaccgacaccccggacgcgttcgccggt
gcgcaggacgcgctgcgagaggctgtcgccatcggcgacaccggcgagaagcccaccgcc
cctttgctcctcggtcgaatcggggtctga

DBGET integrated database retrieval system