KEGG   Nocardia brasiliensis: O3I_005515Help
Entry
O3I_005515        CDS       T02270                                 

Definition
(GenBank) glycerol kinase (ATP:glycerol 3-phosphotransferase) (Glycerokinase) (GK)
  KO
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    O3I_005515
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     O3I_005515
Exosome [BR:nbr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   O3I_005515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1279042..1280541)
Genome map
AA seq 499 aa AA seqDB search
MRRYVAAIDQGTTSSRCIVFDRQGRVVGVAQREHEQIFPRRGWVEHDAESIWQNTETVLG
EVLDEHDLSAGDIAAVGVTNQRETTVVWDRATGKPIHHAIVWQDTRTDRLTTELGGDIGP
TRYQERTGLPLSTYFAGPKLRWLLDHVDGARDRAEAGELCFGTIDSWVLWNLTGEHITDV
TNASRTMLMDLRTRQWDSQICAEFGVPEAMLPQIRSSSEVYAEINSGPLQGVPVAGILGD
QQAATFGQACLSPGEAKNTYGTGNFMLLNTGTTPVVSQHGLLTTVCYQLGDADAVYALEG
SIAVTGSLVQWFRDNLGIISSAEEIEPLARSVEDNGGAYIVPAFSGLFAPRWRPDARGVI
AGLTRFVNKAHLARAVLESTAFQTREVVDAMRADAESEHLDLELTTLKVDGGMVGNDLLM
QFQSDILDVPVVRPVVNETTALGAAYAAGLAVDFWSSTDDIKENWSADKTWEPTMSDADR
DEHLRAWNKAVERTYGWAD
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcgctatgtggccgccatcgaccagggcacgacctcgagtcggtgcatcgtcttc
gatcggcaagggcgcgtcgtcggcgtcgcccagcgcgaacacgagcagatcttcccgcgc
cggggctgggtcgagcacgacgccgaatccatctggcagaacaccgaaacagtgctcggc
gaggtgctcgacgagcacgatctgagcgccggcgacatcgccgccgtcggggtcaccaat
cagcgcgagaccaccgtggtgtgggaccgggccaccggcaagccgatccaccacgccatc
gtgtggcaggacacccgcaccgaccggctcaccaccgaactcggcggcgatatcgggccg
acccgctaccaggaacgcaccgggctgccgctgtccacctacttcgccgggccgaagctg
cgctggctgctggaccacgtggacggcgcccgcgaccgcgccgaggccggcgagctctgc
ttcggcaccatcgacagctgggtgctgtggaacctcaccggcgagcacatcacggacgtg
accaacgcctcgcgcaccatgctgatggatctgcgcacccggcaatgggattcgcagatc
tgcgccgagttcggtgtgccggaggcgatgctgccgcagatccgcagctcctcggaggtg
tacgcggagatcaattccggcccgctgcaaggggtgccggtcgcgggcatcctcggcgac
cagcaggccgccaccttcggccaggcctgcctttcgcccggcgaggccaagaacacctac
ggcaccggcaatttcatgctgctcaacaccggcaccacaccggtggtgagccagcacggc
ctgctcaccaccgtctgctatcagctcggcgacgcggacgcggtgtacgcgctggaaggc
tcgatcgcggtgaccggctcactggtgcagtggttccgggacaacctgggcatcatctcg
tccgccgaggagatcgaaccgctggcgcgcagcgtcgaggacaacggcggcgcctacatc
gtgcccgccttctccgggctgttcgcgccgcgctggcggccggacgcgcgcggggtgatc
gccgggctgacccgcttcgtgaacaaggcccacctggcccgagcggtgctggagtccacc
gcttttcagacccgcgaggtggtcgacgccatgcgcgccgacgccgaatccgagcacctc
gacctggaactcaccaccttgaaggtggacggcggcatggtcggcaacgatctgctgatg
cagttccagtccgacatcctcgacgtgcccgtggtgcgcccggtggtcaacgagaccacc
gcgctcggcgccgcctacgccgcgggcctggcggtcgacttctggtcgagtaccgatgac
atcaaagagaactggtccgcggacaagacctgggaacccaccatgtccgatgcggaccgc
gacgagcatctgcgggcctggaacaaggccgtagagcgcacctacgggtgggccgactga

DBGET integrated database retrieval system