KEGG   Nocardia brasiliensis: O3I_006195Help
Entry
O3I_006195        CDS       T02270                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    O3I_006195
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3I_006195
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    O3I_006195
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     O3I_006195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1427676..1428737
Genome map
AA seq 353 aa AA seqDB search
MHSRWPGLIAAYRDRIAGARDWEPVTLLEGGTPLVPAPHLSELTGCEVYLKVEGLNPTGS
FKDRGMTVAITDAKYQGQKAVLCASTGNTSASAAAYATRADMTCAVLIPQGKIAMGKLAQ
AVMLGAKIIQVDGNFDDCLELARKVTSDFPSIGLVNSVNPARIEGQKTASFEICDVLGRA
PDVHALPVGNAGNITAYWRGYREYYADGITTQLPRMLGVQAAGAAPLVHGAPVSDPETIA
TAIRIGAPASWNAAVAAKEESGGAFRAATDEEILAAYRLVAATEGVFVEPASAASVAGLL
AARTEGWLDSGLTVVCTVTGNGLKDPDTALLGMPQVQAIPVDPVAVAAELELA
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
gtgcattctcgttggccggggttgatcgcggcctatcgcgaccggatcgccggtgcgcgg
gactgggagccggtcaccctgctcgagggcggtacgccgctggtgcccgcaccgcatctg
tccgagctgaccgggtgtgaggtatatctcaaggtcgagggcctgaatccgaccggctcg
ttcaaggaccgcggtatgaccgtggccatcaccgacgcgaagtaccagggccagaaggcg
gtgctctgcgcctccaccggcaatacctcggcatccgccgcggcctacgccacccgcgcg
gacatgacctgtgcggtgctcatcccgcagggcaagatcgcgatgggcaagctggcccag
gcggtcatgctgggcgcgaagatcatccaggtggacggcaacttcgacgactgcctcgaa
ctcgcgcgcaaggtgacctccgatttcccgagcatcggcctggtgaactcggtgaacccg
gcccgcatcgaggggcagaagaccgcctcgttcgagatctgcgacgtgctgggccgcgcg
cccgacgtacacgcgctgccggtcggaaatgcgggcaatatcacggcctactggcggggc
tatcgcgagtactacgccgacggcatcaccacgcagctgccgcgcatgctcggcgtgcag
gccgcgggcgccgcaccgctggtgcacggcgccccggtgagcgacccggagaccatcgcg
acggccatccggatcggtgcgccggcgtcgtggaacgccgcggtcgcggccaaggaggag
tccggtggggccttccgcgccgccaccgacgaggagatcctcgcggcgtaccggctggtc
gcggcgaccgagggcgtgttcgtcgaacccgcgtcggccgcgagcgtcgcgggtctgctc
gccgcgcgcaccgagggttggctggattccggcctcaccgtcgtgtgcaccgtgaccggt
aacggactcaaggatcccgacaccgccctgctgggaatgccgcaggtgcaggcgattccg
gtggacccggtcgcggtcgccgccgagctagagctggcctga

DBGET integrated database retrieval system