KEGG   Nocardia brasiliensis: O3I_007430Help
Entry
O3I_007430        CDS       T02270                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K16438  
5-epimerase [EC:5.1.3.-]
Organism
nbr  Nocardia brasiliensis
Pathway
Staurosporine biosynthesis
Polyketide sugar unit biosynthesis
Biosynthesis of vancomycin group antibiotics
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    O3I_007430
   01055 Biosynthesis of vancomycin group antibiotics
    O3I_007430
  Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    O3I_007430
Enzymes [BR:nbr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.-  
     O3I_007430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1700108..1700725)
Genome map
AA seq 205 aa AA seqDB search
MSSVEVRKLAIEGAVEFSVPVYRDSRGLFTSPFQIDAFDAALGHGLFPVRDISHNVSARG
VLRGIHYTTTPPGRSKYVYVPHGRVTDYLVDLRVGSPTFGRWDQTELGGDGATAKALFIP
MGVGHAFLSQEDDSIVVYVMSEGYEAANELAVSPLDPEIGLPIPRIPRPEQSERDRAALT
LAQAGERGLLPDYATCLELEAKLWH
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggtcgaggtcagaaagctcgccatcgagggcgcggtggagttctccgtgccg
gtataccgggacagccgtggacttttcaccagcccgttccagatcgacgcgttcgacgcg
gcgctcggtcacggcctgttcccggtccgcgacatcagccacaacgtctcggctcgcggc
gtactacgcggcatccactacacgaccaccccgccggggcgctcgaagtacgtgtacgtc
ccacacggccgcgtcaccgactacctggtcgacctccgcgtcggctcaccgaccttcggc
cgttgggaccaaacggaattgggcggcgacggtgcgacagccaaggcgttgttcatcccg
atgggcgtcggccacgccttcctctcgcaggaggacgattcgatcgtggtctacgtgatg
tcggaggggtacgaagcggccaacgaattggccgtctccccgctggacccggagatcggt
ctgccgatcccccggatcccccgtccggagcagtccgaaagagaccgcgccgcattgact
ctcgcgcaggcgggcgaacgcggactgctgcccgactacgcgacctgcctcgagctggag
gcgaaactgtggcactga

DBGET integrated database retrieval system