KEGG   Nocardia brasiliensis: O3I_007430Help
Entry
O3I_007430        CDS       T02270                                 

Definition
(RefSeq) dTDP-4-dehydrorhamnose 3,5-epimerase
Organism
nbr  Nocardia brasiliensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1700108..1700725)
Genome map
AA seq 205 aa AA seqDB search
MSSVEVRKLAIEGAVEFSVPVYRDSRGLFTSPFQIDAFDAALGHGLFPVRDISHNVSARG
VLRGIHYTTTPPGRSKYVYVPHGRVTDYLVDLRVGSPTFGRWDQTELGGDGATAKALFIP
MGVGHAFLSQEDDSIVVYVMSEGYEAANELAVSPLDPEIGLPIPRIPRPEQSERDRAALT
LAQAGERGLLPDYATCLELEAKLWH
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagctcggtcgaggtcagaaagctcgccatcgagggcgcggtggagttctccgtgccg
gtataccgggacagccgtggacttttcaccagcccgttccagatcgacgcgttcgacgcg
gcgctcggtcacggcctgttcccggtccgcgacatcagccacaacgtctcggctcgcggc
gtactacgcggcatccactacacgaccaccccgccggggcgctcgaagtacgtgtacgtc
ccacacggccgcgtcaccgactacctggtcgacctccgcgtcggctcaccgaccttcggc
cgttgggaccaaacggaattgggcggcgacggtgcgacagccaaggcgttgttcatcccg
atgggcgtcggccacgccttcctctcgcaggaggacgattcgatcgtggtctacgtgatg
tcggaggggtacgaagcggccaacgaattggccgtctccccgctggacccggagatcggt
ctgccgatcccccggatcccccgtccggagcagtccgaaagagaccgcgccgcattgact
ctcgcgcaggcgggcgaacgcggactgctgcccgactacgcgacctgcctcgagctggag
gcgaaactgtggcactga

DBGET integrated database retrieval system