KEGG   Nocardia brasiliensis: O3I_009240Help
Entry
O3I_009240        CDS       T02270                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
nbr  Nocardia brasiliensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    O3I_009240
Enzymes [BR:nbr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     O3I_009240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2103931..2104806)
Genome map
AA seq 291 aa AA seqDB search
MAEKTDVASIAVLGSINMDLVTTTRRRPVPGETVLGTGFAMVPGGKGSNQAIAAQRAGGS
VRFVGAVGDDVFADELRRALTDAAVNVDRLRTVTGPSGVAAIVVDDGGENSIIVVGGANA
GLTELTEEDLAVIADADILLCQLEIPIETVAAAARHARANGTTVLLNPSPAQPLPAGLWS
NIDVAVVNSGEAEQLGAALDPVAHVVITRGGDGAVYRGPNSEITEPSPHVEVVDTTGAGD
TFTGALAAAWDRGPEWALKWAVTAGALATTKLGASTSIPTAEQITGALVAE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaaaaacggacgttgcctcgatcgcggtgctcggcagtatcaacatggacctg
gtgaccacgacccggcggcggccggtgcccggggagacggtgctcgggacggggttcgcg
atggtgccgggcgggaaaggctcgaatcaggccatcgcggcgcagcgggcgggcgggtcg
gtgcggttcgtcggggcggtcggtgacgacgtgttcgcggacgagctgcggcgggcgctg
acggacgcggccgtgaacgtggatcggctgcgcaccgtgaccgggccgagcggggtcgcc
gcgatcgtggtggacgacggcggcgagaacagcatcatcgtggtcggcggggcgaacgcc
gggctgaccgagctgaccgaggaggacctcgcggtcatcgccgacgccgatatcctgctg
tgccagttggagatcccgatcgaaacggtcgccgcggcggcccggcacgccagggcgaac
ggcacgacggtgctgctcaacccctcgccggcgcaaccacttcccgccggcctctggtcg
aatattgatgtggcagtggtcaattcgggcgaagccgagcaactcggcgccgcgctggac
ccggtggcacacgtggtgatcacccgcggcggcgacggtgcggtctatcgcgggccgaac
agcgagatcaccgagcccagcccgcacgtcgaggtggtcgacaccaccggcgcgggcgac
accttcaccggcgcgctcgccgcagcctgggatcgcggccccgaatgggcgctgaagtgg
gcggtcaccgcgggcgccctggccacgaccaagctcggcgccagcacctccatccccacc
gccgagcagatcaccggggcgctcgtcgccgaatag

  All links  
No link information was found.   
DBGET integrated database retrieval system