KEGG   Nocardia brasiliensis: O3I_011310Help
Entry
O3I_011310        CDS       T02270                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nbr  Nocardia brasiliensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_011310
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    O3I_011310
  Amino acid metabolism
   00310 Lysine degradation
    O3I_011310
Enzymes [BR:nbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     O3I_011310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2559608..2561380)
Genome map
AA seq 590 aa AA seqDB search
MAFSVQMPALGESVTEGTVTRWLKQEGDTVEVDEPLLEVSTDKVDTEIPSPTAGVLSKIV
AQEDDVVEVGGELGVISEAGEAPAPSSAPEPEAAAAPAQEAPAEEAAEPEPAQEAPAQEA
APAPAASASAGDGTPVKMPELGESVTEGTVTRWLKAVGDEVAVDEALLEVSTDKVDTEIP
SPVAGTLLEITAQEDDVVAVGGQLGVIGSGAPAAAAPKAPAPEPKPEPKPEPKPEPKPEP
KPEPAAAAPAPAPKAPAPAPAKAPDATATESDSAGNGATPYVTPLVRKLADENGVDLSAL
TGSGVGGRIRKQDVLAAAEAKKAPAPAAAAPAAKAPAAKAAPAPSAQLAHLRGTVQKANR
IRQITATKTLESLRTTAQLTQVHEADVTKIAQLRAQAKAAFKEREGVNLTFLPFFAKAVV
EALGVHPNVNASYDDSTKEVTYHAAVHLGIAVDTEQGLLSPVIHNASDLSLAGLARAIAD
IANRARNGGLKPDELAGGTFTITNIGSQGALFDTPILLPPQAGMLGTGAIVKRPVVVKDD
TGSESIGVRSMCYLPLTYDHRLVDGADAGRFLTTIRHRLEEAAFEADLGL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggccttctccgtccagatgccagctcttggtgagagcgtcaccgagggaacggtcacc
cggtggctgaagcaggaaggagacacggtcgaggtcgacgagccgctgctcgaggtctcc
accgacaaggtcgacaccgaaatcccgtcccccacggcgggcgtgctgtcgaagatcgtc
gcccaagaagatgatgtggtcgaggtcggcggtgagctcggcgtgatcagcgaggccggt
gaggcgcccgcaccgagctcggcccccgaacccgaggccgctgccgcgcccgcgcaggaa
gcgcccgccgaggaagccgccgagcccgagcccgcgcaggaagccccggctcaggaagcg
gcccccgcgcccgccgcgagcgcgtccgccggtgacggcaccccggtcaagatgcccgag
ctgggcgagtcggtcaccgagggcaccgtcacccggtggctgaaggccgtcggcgacgag
gtcgccgtggacgaagcgctgctcgaggtctccaccgacaaggtcgacaccgagatcccc
tcgccggtcgcgggcacgctgctcgagatcaccgcgcaggaagacgatgtcgtcgctgtg
ggtggacagctcggcgtgatcggcagcggcgcccccgcggccgccgcgcccaaggcaccg
gcccccgagccgaagcccgagcccaagccggaacccaagcccgagcccaagccggaaccg
aagcccgagcccgcggccgccgccccggcacccgcacccaaggctccggcacccgccccg
gccaaggcgcccgacgccaccgcgaccgagtcggattccgccggtaacggcgccaccccg
tacgtcactccgctggtgcgcaagctggccgacgagaacggcgtcgacctgtccgcgctc
accggttccggtgtcggcggccgcatccgcaagcaggacgtgctcgcggccgcggaagcc
aagaaggcgcccgccccggctgcggccgcgcccgccgcgaaggccccggccgccaaggcc
gcgcccgcgccgagcgcacagctggcgcacctgcgcggcaccgtgcagaaggcgaaccgg
atccggcagatcaccgcgaccaagaccctggaatcgctgcgcaccaccgcgcagctgacc
caggtgcacgaggccgatgtcaccaagatcgcgcagctgcgggcacaggccaaggcggcg
ttcaaggagcgcgagggcgtcaacctgacgttcctgccgttcttcgccaaggccgtcgtc
gaggcgctcggtgtgcacccgaacgtcaacgccagctacgacgacagcaccaaagaggtc
acctaccacgcggccgtgcacctcggcatcgccgtggacaccgagcagggcctgctctcc
ccggtgatccacaacgcgagcgacctgtcgctggccggcctggcccgcgccatcgccgat
atcgccaaccgcgcgcgcaacggtggcctgaagcccgacgagctcgccggcggcaccttc
accatcaccaacatcggcagccagggcgcgctgttcgacaccccgatcctgctcccgccg
caggcgggcatgctcggtaccggcgcgatcgtcaagcgcccggtcgtggtgaaggacgac
acgggcagcgagtccatcggtgtccgttcgatgtgctacctgccgctcacttacgaccac
cgcctggtcgacggtgccgacgcgggccgcttcctgaccacgatccggcaccggctcgag
gaggcggcgttcgaggccgacctcggtctgtaa

DBGET integrated database retrieval system