KEGG   Nocardia brasiliensis: O3I_012315Help
Entry
O3I_012315        CDS       T02270                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
nbr  Nocardia brasiliensis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nbr01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:nbr00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2786836..2788173
Genome map
AA seq 445 aa AA seqDB search
MTTRIELARVDLRGRTPSVAELRAALPRGGVDVDSVLHQVRPVVEAIRDHGVSAAQEYSE
KFDGVIPATVRVPAAELEKALAGLDPAVRAALEESIARARKVHADQRRTDKTTEVVPGGT
VTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQTAGVGSLVVASPPQAQFGGLPHPTIL
AAAQLLGVDEVWAVGGAQGVALLSYGGVDTDGAQLEPVDLITGPGNIYVTAAKRLCRGLV
GIDAEAGPTEIAILADATADPGHVAADLISQAEHDVLAASVLVTDSAALADAVDAALTRQ
LSVVKHAHRVTEALRGKQSGTVLVDDIEQGLRVVNAYAAEHLEIQTADAAAVAGRVRSAG
AVFVGAYAPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVAGH
VVALANAEDLPAHGQAVQARFEALS
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgacaacccgcatcgagctcgcccgcgtcgatttgcgcggtcgcactccctccgttgcc
gagctgcgcgccgcgctgccgcgcgggggagtcgacgtggactcggtgctgcatcaggtg
cggccggtggtggaagcgatccgggaccatggcgtttcggcggcgcaggagtacagcgag
aagttcgacggtgtgatcccggccacggtgcgggtgcccgcggccgagctggaaaaggcg
ctggccggcctcgatcccgcagtgcgcgccgcgctggaggagtccatcgcccgggccagg
aaggtgcacgccgatcagcgccgcaccgacaagaccaccgaggtggtgcccggcggcacc
gtgaccgagcgctgggtgccggtcgagcgggtcgggctgtatgtgcccggcggtaacgcg
gtgtacccgtcgagcgtggtgatgaacgtggtgcccgcgcagaccgcgggcgtcggttcg
ctggtggtcgcctcgccgccgcaggcgcagttcggcggcctgccgcaccccaccatcctg
gccgccgcgcagttgctcggcgtcgacgaggtgtgggcggtcggcggcgcgcagggcgtg
gcgttgctgtcctacggcggcgtcgacaccgacggcgcgcagctggaaccggtcgacctg
atcaccggtccgggcaacatctacgtgaccgcggcgaagcggctgtgccgcggcctggtc
ggcatcgacgcggaagcgggcccgaccgagatcgcgatcctggccgacgccaccgccgat
cccggccacgtggccgccgacctgatcagccaggccgagcacgacgtgctcgccgccagc
gtgctcgtcaccgacagtgcggcgctggccgacgcggtcgatgccgcgctgacccggcag
ctgagcgtggtgaagcacgcgcaccgggtcaccgaggcgttgcgcggcaagcaatccggc
acggtgctggtcgacgatatcgagcagggcctgcgggtggtcaacgcctacgcggccgaa
cacctggagatccagaccgccgacgccgccgcggtggcgggccgggtgcgcagtgccggt
gcggttttcgtcggcgcgtacgctccggtgagcctcggcgactactgcgccgggtccaac
cacgtgctgccgactgccggatgcgcaaggcactcttcgggtttgagtgtgcagacgttc
ctgcgcggtatccacgtggtggagtacaccgaggcggcgctgaaggatgtcgccggacac
gtggtggcgctggcgaatgccgaggatctgcccgcgcacggccaggccgtgcaggcgcgt
ttcgaggcgctgtcatga

DBGET integrated database retrieval system