KEGG   Nocardia brasiliensis: O3I_012415Help
Entry
O3I_012415        CDS       T02270                                 

Definition
(GenBank) tryptophan synthase subunit beta (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    O3I_012415
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3I_012415
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3I_012415
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     O3I_012415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2801861..2803123
Genome map
AA seq 420 aa AA seqDB search
MTTVSGLPAASEGVAHRSAHEPDTGGHFGVYGGRHVPEALMAVIEEVTATYEKSRLDPDF
LNELDRLQRDYTGRPSPVFECTRLAEHAGGARILLKREDLNHTGSHKINNVLGQALLAKR
MGKTRVIAETGAGQHGVATATACALLGLDCVIYMGAVDTARQALNVARMRLLGAEVISVT
TGSQTLKDAINEALRDWVSNADDTYYCFGTAAGPHPFPMLVRDFQRVIGLEARVQVQEST
GQLPDAVVACVGGGSNAIGIFHAFIDDAEVRLVGYEAAGDGVETGRHAATFTGGTPGAFQ
GAYSYLLQDEDGQTIESHSISAGLDYPGVGPEHAYLKDIGRAEYRPVTDTEAMDALLLLS
RTEGIIPAIESAHAVAGALQLGKELGPGSVILVNLSGRGDKDMDTAARWFGLLDEGAEQS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
gtgacgacggtgagcggtctacccgcggccagtgaaggcgtcgcgcaccgcagtgcgcac
gagcccgacaccggcggccacttcggcgtctacggcggcaggcatgtgcccgaggcgctg
atggcggtcatcgaagaggtcaccgcgacctacgagaagtcccggctggacccggacttc
ctgaacgaactcgatcggttgcagcgggactacaccgggcggccgtcgccggtgttcgag
tgcacccggctcgccgagcacgcgggcggcgcccgcatcctgctcaagcgcgaagacctg
aaccacaccggttcgcacaagatcaacaacgtgctcggtcaggcgctgctcgccaagcgg
atgggcaagacccgcgtgatcgcggagaccggcgccggccagcacggtgtcgccaccgcc
accgcgtgcgcgctgctcggcctcgactgcgtgatctacatgggcgccgtcgacaccgcg
cggcaggcgctgaacgtggcgcgcatgcgcctgctcggcgccgaggtgatctcggtgacc
accggttcgcagacgctcaaggacgcgatcaacgaggcgctgcgcgactgggtcagcaac
gccgacgacacctactactgcttcggcacggcagcgggcccgcacccgttcccgatgctg
gtgcgcgacttccaacgcgtcatcgggctggaggcccgggtgcaggtgcaggagtcgacc
gggcagttgccggacgcggtcgtcgcctgcgtcggcggcggctccaacgccatcggcatc
ttccacgccttcatcgacgacgccgaggtccggttggtcggttacgaggcggccggtgac
ggcgtcgaaaccggaaggcacgcagccacgttcaccggcggcacgccgggcgcgttccag
ggcgcgtactcgtacctgctgcaggacgaggacggccagaccatcgagtcgcactccatc
tcggccggtctggactacccgggcgtcgggcccgagcacgcctacctcaaggacatcggc
cgcgccgagtaccgcccggtcaccgacaccgaggcgatggacgcgctgctgctgctcagc
cgcaccgagggcatcatcccggcgatcgagtccgcgcacgcggtcgcgggcgccctgcaa
ctgggcaaggaactcgggcccggctcggtcatcctggtcaacctctccgggcgcggtgac
aaggacatggacaccgcggcgcgctggttcgggctgttggatgaaggggcagagcagtca
tga

DBGET integrated database retrieval system