KEGG   Nocardia brasiliensis: O3I_012420Help
Entry
O3I_012420        CDS       T02270                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase subunit alpha (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    O3I_012420 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3I_012420 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    O3I_012420 (trpA)
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     O3I_012420 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2803188..2803988
Genome map
AA seq 266 aa AA seqDB search
MSQQSRLANTFAAARGEGRAALIGYLPAGYPDLAGSIEVCRTMVESGCDIVEVGVAYSDP
VMDGPTIQAAADQALRGGVRVRDVFSVVEAITGAGGQAVVMSYWNPVLKYGVDRFARDLA
AAGGAGIITPNLIPDEADDWFVASSTHNLDRIFLVAPSSTEERLVKTLEASRGFVYAAST
MGVTGARDVVSSAAPALCARIRAHSDIPIGVGLGVRSGAQAAEIASYADGVIVGSALVSA
AGESLDAVRALTAELAEGVRSATVAS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcagcagtctcgccttgcgaacacctttgccgccgcgcgcggtgaagggcgggcc
gcgctcatcggctacctgccggcgggttaccccgatctggccggttccatcgaggtctgc
cgcaccatggtcgaatccggttgcgacatcgtcgaagtcggcgtcgcctactccgacccg
gtgatggacggcccgaccatccaggccgcggccgatcaggcgctgcgcggcggggtgcgg
gtgcgcgacgtgttctccgtcgtggaggcgatcaccggggccggcggtcaggcggtcgtc
atgagctactggaatccggtgctgaagtacggcgtcgaccgtttcgcgcgcgatctcgcc
gcggcgggcggggccggaatcatcacgcccaacctgattcccgacgaggccgacgactgg
ttcgtcgcctcgtccacgcacaacctggaccgcatcttcctggtcgcgccgtcctccacc
gaggagcgtctggtgaagactttggaggcgtcgcgcgggttcgtctacgcggcgtcgacc
atgggtgtcaccggtgcgcgcgacgtggtctcctcggcggcgcccgcgctgtgcgcgcgg
atccgggcacactccgatatcccgatcggcgtcggtctcggcgtgcgctcgggtgcgcag
gcggccgaaatcgcctcctacgcagacggagtcatcgtcggctcggccttggtgagtgcc
gcgggcgagagcctggacgcggtgcgcgcgctgaccgccgagctggccgagggcgtgcgc
tcggcgaccgtcgcgtcgtag

DBGET integrated database retrieval system