KEGG   Nocardia brasiliensis: O3I_015350Help
Entry
O3I_015350        CDS       T02270                                 

Definition
hypothetical protein
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
nbr  Nocardia brasiliensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3433065..3434765
Genome map
AA seq 566 aa AA seqDB search
MAYRRFCLLAGVAAVALSGCSAPTAERLVAEIRADSNRDGVVDDKDAGAEMNGAIILPNI
GDVARRCPSSTSQLPDAELAACHDAADEVARAPEYLAPLVTLPIGDPADATGQVAAVGAG
ADKIRIFVKRQDTWVPLRPDTNLTEIELRNGATLGVDARDVVRDKTIWDGTVTVRFTVRR
GARTETDDVVLRVAPVVLHNHTQPAQSVLVPESGDDRSHEQFVSEFGAAAKASGIDAPLV
RMRTTDTWGQDFVEIGYVSMPGPGGKNVSLRIAIRSPQPEREGGRAVFDLKGPGVGAIQL
GGFDNRLVDAFGNVETIPPHIHNGREFPTGRVIIGTGNADDPAVRSGELEKFFAAQQVQT
PVLLDAGWLVVGHVDEFVQFLPATGGRGWRPAVSDPRRGLEILRELQRGGHGGERALSRP
DVSERTIDEVLADEKFVARNEVAARKIDENVERLVREVGFRPEEFVRIPGLYESGGIPEA
PEGLVAFYPGAINGVLMNASNYVAPRQWGPIVDGRDVFEAAVTEAYRSVGLTVRYVDDWE
SLHLGGGEIHCGSNVLRQIEQRWTAP
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcgcaggttctgcctgctcgccggcgtcgcggcggtggcactgtccggctgt
tcggcgcccaccgcggagcggctcgtcgcggagatccgggccgacagcaatcgggacggg
gtcgtcgacgacaaggatgccggtgccgagatgaacggcgcgataatcctgccgaatatc
ggcgatgtcgcgcggcgttgcccgtcgagcacgagtcagctccccgatgcggagctggcg
gcctgtcacgacgccgccgacgaggtggcccgcgcaccggaatatctggcgccactggtg
acgctgccgatcggcgacccggcggacgcgacgggacaggtggcggcagtaggcgccggg
gcggacaagatccggatattcgtcaaacgacaggacacgtgggtaccgctgcgacccgac
acgaacctgaccgagatcgagctgcgaaatggggcgaccctcggtgtagacgcccgagac
gtggtgcgtgacaagacgatctgggatggcacggtcacggtgcggttcaccgttcgacgg
ggcgctcgcacagagaccgacgatgtcgtgctccgcgtcgcgcccgtcgtcctgcacaac
cacacccagcccgcacagtcggtgctggtgcccgagagcggcgacgatcgatcgcacgag
cagttcgtgagcgaattcggcgcggccgcaaaggcttcggggatcgacgcgccactggtc
cgaatgcgcaccaccgatacctggggtcaggacttcgtggagatcggctacgtgtcgatg
cccggacccggcggcaagaacgtctcgctgcgcatcgcgatccgctcgccgcagccagag
cgcgagggcggccgcgccgtgttcgacctcaaaggccccggcgtgggcgcgattcagctc
ggcggcttcgacaaccggctggtggacgcgttcggaaacgtggaaacgataccgccgcat
atccacaacgggcgcgagtttcccaccggccgggtgatcatcggcaccggcaacgcggac
gatcctgccgtgcgcagcggggaactggagaaattctttgccgcgcagcaggttcagacg
ccggtgctgctggacgccggatggctggtggtcggccacgtcgacgagttcgtccagttc
ctgccggcgaccggcggtcgcggttggcggcccgccgtctccgacccccggcgcgggctg
gagatcctgcgcgaactgcagcgcggcgggcacggcggcgaacgggcactgtcgcggccg
gatgtctccgagcgcaccatcgacgaggtgctcgcggacgaaaagttcgtcgcccgaaac
gaagtcgccgcccgcaagatcgacgagaacgtcgagcgcctggtccgtgaggtcggcttc
cggccggaagagttcgtccggatccctgggctctacgaatccggtggtattccggaagcg
cccgagggtctggttgccttctacccgggcgccatcaacggcgtgctgatgaacgcctcg
aactacgtcgctccccgccagtggggcccgatcgtcgacggtcgcgatgtcttcgaagcc
gcggtcaccgaggcataccgatcggtgggcctgacggtgcgttacgtggacgactgggag
tccctccacctgggtggcggcgaaatccattgcggatcaaacgttctacgacaaatcgag
cagcggtggaccgcaccgtag

DBGET integrated database retrieval system