KEGG   Nocardia brasiliensis: O3I_015660Help
Entry
O3I_015660        CDS       T02270                                 

Definition
pyridoxal-5'-phosphate-dependent protein subunit beta
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nbr  Nocardia brasiliensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    O3I_015660
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    O3I_015660
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    O3I_015660
Enzymes [BR:nbr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     O3I_015660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3502528..3503676)
Genome map
AA seq 382 aa AA seqDB search
MNSSAEPFLYDRSGRRYEISSPRWRGDDGTPLAVSPMPGIDPEQIVTSERSLWRYQAVIP
VPARHRISLGEGATPMVPLDWDGRRVHFKLEWFNPTSSFKDRGVAVMMSHLAGQGVTKVL
EDSSGNGGSAVAAYCAAAGLGAKILVPELTSAAKILQAKAYGAEIELVAGTRDEVAAAAI
RQSARLTYASHNWHPFFLQGTKTVAYEMWEDLGFRAPDNVVLVAGAGSNVLGCDIAFGEL
LGAGRIERLPRLLIGQPEHWATIADTCNGLDPADRGPREPTIAEGAAIADPVRLPEAVAA
IRRSGGAAVAVPDSAIGAAVGKLAARGLYAEPTSCVAVAALDHFLAEGVIAADETTVVVL
TGSGLKSSEQMARVFDRSPAVE
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcttctgccgaaccgttcctctacgaccgttcgggtcgccgctatgagatctcg
agcccgcgctggcgcggtgacgacggcactcccctggccgtcagccccatgccgggtatc
gacccggagcagatcgtgacgtccgaacgctcgctgtggcggtatcaggcggtgatcccg
gttccggcgcggcatcggatcagcctcggcgaaggtgcgacgccgatggtgccgctcgac
tgggatggccggcgggtgcacttcaaactcgaatggttcaaccccacttcgagtttcaag
gatcgcggggtcgcggtgatgatgtcgcacctggccggtcagggcgtcacgaaggtcctc
gaggacagttccggcaacggcgggtccgcggtcgccgcctattgcgcggccgccggactc
ggcgccaagatcctcgtgcccgagctgacctcggccgcgaagatactgcaggccaaggcc
tatggcgccgagatcgaactggtggcgggcacccgcgacgaggtggccgccgcggcgatc
cgccagtccgcgcggctgacctacgccagccacaactggcatccgttcttcttgcagggc
accaagaccgtcgcctacgagatgtgggaggacctcggcttccgcgcacccgacaatgtc
gtgctcgtcgccggcgccggcagcaacgtgctcggctgcgatatcgcgttcggcgaattg
ctcggggcgggccggatcgaacgcctgccgcggctgctgatcggccagcccgaacactgg
gccaccatcgccgacacctgcaacggcctcgacccggccgaccgtggaccacgcgaaccc
acgatcgccgagggcgccgccatcgccgacccggtccggttacccgaggcagtcgcggcg
atccgccgttccggcggcgcggccgtcgccgttcccgattcggcgatcggagccgcggtg
ggcaagctcgcggcgcgtgggctctacgccgaacccaccagctgcgtcgccgtcgccgca
ctggatcactttctcgccgaaggcgtcatcgccgccgacgagaccaccgtcgtcgtgctc
accggttccggactcaaatcgtcggagcagatggcccgcgtcttcgaccggtcaccggcg
gtcgagtga

DBGET integrated database retrieval system