KEGG   Nocardia brasiliensis: O3I_016180Help
Entry
O3I_016180        CDS       T02270                                 

Definition
(GenBank) urate oxidase
  KO
K00365  urate oxidase [EC:1.7.3.3]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00230  Purine metabolism
nbr01100  Metabolic pathways
nbr01120  Microbial metabolism in diverse environments
Module
nbr_M00546  Purine degradation, xanthine => urea
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    O3I_016180
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    O3I_016180
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     O3I_016180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Uricase
Motif
Other DBs
NCBI-ProteinID: AFU01197
UniProt: K0EUK2
Position
3612120..3612995
Genome map
AA seq 291 aa AA seqDB search
MSIKLGPNRYGKAETHVVGVTKNGGVHEIRDLNVGVALSGDMDDVHLTGDNGAVLPTDTQ
KNTVFAFAKEHGITSPEAFGVLLAQHFVGSQPTIHHARVSVEEHAWERIVLNPGDDQHSF
VRSGQETRIARVHHDGEKTWVVAGLQGLVVLNSTGSEFHGYIKDKYTTLQEAYDRILATE
VNAEWRFIAEPSDWDKTYREARGALLAAFAETYSYSLQQTLYAMGERVLAACPEIGEVRL
SLPNKHHFVVDLSAFGLTNDNEVFYAADRPYGLIEGTVLREDAPSAGPAWE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcaagctcgggccgaaccgatacggcaaggcggagacccacgtcgtcggcgtg
acgaaaaacggtggcgtgcacgagatccgcgatctcaatgtcggtgtggcgctctccggc
gacatggacgatgtgcacctcaccggcgacaacggcgcggtcctgccgacggacacgcag
aagaacaccgtcttcgccttcgccaaggagcacgggatcacctcgcccgaggcgttcggt
gttctgctggcacagcatttcgtcggctcgcagccgaccatccaccacgcgcgggtcagc
gtcgaggaacacgcctgggagcggatcgtgctgaatcccggcgacgatcagcactcgttc
gtccgctcgggtcaggagacccgcatcgcacgggtgcaccacgacggcgaaaagacctgg
gtggtagcgggtttgcagggcctggtggtactgaactccaccggctcggagttccacggc
tatatcaaggacaagtacacgaccctgcaggaagcctacgaccgcatcctggccaccgag
gtcaacgcggagtggcgtttcatcgccgagccgagcgactgggacaagacttaccgcgag
gcgcgcggcgccctgctggcggcgttcgccgagacctacagctactcgttgcagcagacg
ctgtacgcgatgggcgagcgggtgctcgccgcctgcccggagatcggcgaggtacggctg
tcgctgccgaacaaacatcacttcgtggtcgacctgtccgcattcggcctgaccaacgac
aacgaggtgttctacgccgccgaccgcccctacggcctgatcgagggcacggtcctgcgc
gaggacgcgccgtccgccggcccggcgtgggagtga

DBGET integrated database retrieval system