KEGG   Nocardia brasiliensis: O3I_016180Help
Entry
O3I_016180        CDS       T02270                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
nbr  Nocardia brasiliensis
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:nbr00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3612120..3612995
Genome map
AA seq 291 aa AA seqDB search
MSIKLGPNRYGKAETHVVGVTKNGGVHEIRDLNVGVALSGDMDDVHLTGDNGAVLPTDTQ
KNTVFAFAKEHGITSPEAFGVLLAQHFVGSQPTIHHARVSVEEHAWERIVLNPGDDQHSF
VRSGQETRIARVHHDGEKTWVVAGLQGLVVLNSTGSEFHGYIKDKYTTLQEAYDRILATE
VNAEWRFIAEPSDWDKTYREARGALLAAFAETYSYSLQQTLYAMGERVLAACPEIGEVRL
SLPNKHHFVVDLSAFGLTNDNEVFYAADRPYGLIEGTVLREDAPSAGPAWE
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcaagctcgggccgaaccgatacggcaaggcggagacccacgtcgtcggcgtg
acgaaaaacggtggcgtgcacgagatccgcgatctcaatgtcggtgtggcgctctccggc
gacatggacgatgtgcacctcaccggcgacaacggcgcggtcctgccgacggacacgcag
aagaacaccgtcttcgccttcgccaaggagcacgggatcacctcgcccgaggcgttcggt
gttctgctggcacagcatttcgtcggctcgcagccgaccatccaccacgcgcgggtcagc
gtcgaggaacacgcctgggagcggatcgtgctgaatcccggcgacgatcagcactcgttc
gtccgctcgggtcaggagacccgcatcgcacgggtgcaccacgacggcgaaaagacctgg
gtggtagcgggtttgcagggcctggtggtactgaactccaccggctcggagttccacggc
tatatcaaggacaagtacacgaccctgcaggaagcctacgaccgcatcctggccaccgag
gtcaacgcggagtggcgtttcatcgccgagccgagcgactgggacaagacttaccgcgag
gcgcgcggcgccctgctggcggcgttcgccgagacctacagctactcgttgcagcagacg
ctgtacgcgatgggcgagcgggtgctcgccgcctgcccggagatcggcgaggtacggctg
tcgctgccgaacaaacatcacttcgtggtcgacctgtccgcattcggcctgaccaacgac
aacgaggtgttctacgccgccgaccgcccctacggcctgatcgagggcacggtcctgcgc
gaggacgcgccgtccgccggcccggcgtgggagtga

DBGET integrated database retrieval system