KEGG   Nocardia brasiliensis: O3I_017990Help
Entry
O3I_017990        CDS       T02270                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
nbr  Nocardia brasiliensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_017990
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3I_017990
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_017990
Enzymes [BR:nbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     O3I_017990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4029580..4031757
Genome map
AA seq 725 aa AA seqDB search
MTERIQVGGLQVASVLHEFIENEALPGTGVDSAAFWAGAEEVINDLAPRNRALLAERDEI
QGKVDAWHAEHPGANYDKAAYKNFLSEIGYLRPEPADFQISTQNVDDEIATTAGPQLVVP
VMNARFAINAANARWGSLYDALYGTDAISEANGAEKGKSYNKVRGDKVIEWARNFLDDAA
TLITGSHIGSTSYKIVDGELEVGLEDGTEIGLADPSQLVGYLGDSDAPTSVLLKHNGLHI
EIQIDADSPIGSTDTAGVKDLVLESAVTTIMDFEDSVAAVDAEDKVLCYHNWLGLMKGDL
SEQVSKGDQTFTRTMNPDRVYTALDGGELVLHGRSLLFVRNVGHLMTSDAILDADGNEVP
EGILDGLITSLIATHSLRADTELKNSRTGSVYIVKPKMHGPDEVAFTNELFGRIEDVLGV
PRNTLKVGIMDEERRTTVNLKACIQAAAERVVFINTGFLDRTGDEIHTSMEAGPMVRKAE
MKGQQWIKSYEDWNVDTGLATGLPGKAQIGKGMWAMPDLMADMLVQKIGHPKAGANTAWV
PSPTAATLHATHYHQVNVLDRQQEILKGGPRATVDQILEIPLAAAPNWSAEEKQQELDNN
SQSILGYVVRWIDQGVGCSKVPDIEDVALMEDRATLRISSQLMANWLRHGIVTADEVVAS
LERMAPIVDRQNAGDRNYRPLSPDFAGSIAFQAAKELILEGTKQPNGYTEPILHRRRREA
KAACK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcggattcaggtcggcgggcttcaggtggccagcgttctccacgagttcatc
gagaacgaggcgcttcccggaaccggcgtagattccgccgcgttctgggccggtgccgag
gaggtcatcaacgacctcgcgccgcgcaaccgcgcgttgctcgccgaacgcgacgagatc
cagggcaaggtcgacgcctggcacgccgagcaccccggcgcgaactacgacaaggccgcc
tacaagaacttcctgagcgaaatcggctatctgcgccccgagcccgccgatttccagatc
agcacgcagaatgtggacgacgagatcgccaccaccgcgggcccgcagctcgtggtgccg
gtgatgaacgcgcgcttcgcgatcaacgcggccaacgcccgctggggttcgctctacgac
gcgctctacggcaccgacgccatctccgaggccaacggcgcggaaaagggcaagagctac
aacaaggttcgcggcgacaaggtcatcgagtgggcgcgtaacttcctcgacgacgcggcg
accctgatcaccggctcgcacatcggctccacctcgtacaagatcgtcgacggtgagctc
gaggtcggcctcgaggacggcaccgagatcgggctcgccgatccgtcgcagctggtcggt
tacctcggcgattcggacgcgccgacctcggtgctgctgaagcacaacggtctgcacatc
gagatccagatcgatgcggactcgccgatcggcagcaccgacaccgcgggcgtgaaagat
ctggtgctggagtccgcggtcaccacgatcatggacttcgaggactcggtcgccgcggtc
gacgccgaggacaaggtgctctgctaccacaactggctcggcctgatgaagggcgatctc
agcgagcaggtcagcaagggcgaccagaccttcacccgcaccatgaacccggaccgggtc
tacaccgcgctcgacggcggtgagctggtgctgcacggccgttcgctgctgttcgtgcgc
aacgtcggtcacctgatgaccagcgacgccatcctcgacgccgacggcaacgaggtgccc
gagggcatcctcgacggcctgatcacctcgctcatcgcgacgcattcgctgcgcgccgac
accgaactgaaaaacagccgcaccggctcggtctacatcgtgaagccgaagatgcacggc
cccgacgaggtcgcgttcaccaacgagctgttcggccggatcgaagacgtgctcggcgtg
ccgcgcaacaccctcaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctg
aaggcctgtatccaggctgccgccgaacgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaggccgggccgatggtccgcaaggccgag
atgaagggccagcagtggatcaagtcctacgaagactggaacgtcgacaccggcctggcc
accggactgcccggtaaggcacagatcggcaagggcatgtgggccatgccggacctgatg
gccgacatgctggtgcagaagatcggccaccccaaggccggcgccaacaccgcgtgggtg
ccctcgcccaccgccgccaccctgcacgcgacccactaccaccaggtcaacgtgctcgac
cggcagcaggaaatcctcaagggcggcccgcgcgccaccgtcgaccagatcctggagatc
ccgctcgccgcggccccgaattggtcggccgaggagaagcagcaggagctggacaacaac
tcccagtcgatcctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaag
gtgcccgacatcgaagacgtcgcgctcatggaagaccgtgccacccttcgcatttccagc
cagctgatggcgaactggctgcgccacggcattgtcaccgccgacgaggtggtggccagc
ctggaacggatggcgccgatcgtcgaccgccagaacgccggcgaccgcaactaccgcccg
ctgtcgccggacttcgccggcagcatcgccttccaagccgccaaggaactgatcctcgaa
ggcaccaagcagcccaacggctacaccgagccgattctgcaccggcgtcgtcgggaagcc
aaggcggcctgcaagtag

DBGET integrated database retrieval system