KEGG   Nocardia brasiliensis: O3I_017990Help
Entry
O3I_017990        CDS       T02270                                 

Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
nbr  Nocardia brasiliensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    O3I_017990
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3I_017990
   00630 Glyoxylate and dicarboxylate metabolism
    O3I_017990
Enzymes [BR:nbr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     O3I_017990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4029580..4031757
Genome map
AA seq 725 aa AA seqDB search
MTERIQVGGLQVASVLHEFIENEALPGTGVDSAAFWAGAEEVINDLAPRNRALLAERDEI
QGKVDAWHAEHPGANYDKAAYKNFLSEIGYLRPEPADFQISTQNVDDEIATTAGPQLVVP
VMNARFAINAANARWGSLYDALYGTDAISEANGAEKGKSYNKVRGDKVIEWARNFLDDAA
TLITGSHIGSTSYKIVDGELEVGLEDGTEIGLADPSQLVGYLGDSDAPTSVLLKHNGLHI
EIQIDADSPIGSTDTAGVKDLVLESAVTTIMDFEDSVAAVDAEDKVLCYHNWLGLMKGDL
SEQVSKGDQTFTRTMNPDRVYTALDGGELVLHGRSLLFVRNVGHLMTSDAILDADGNEVP
EGILDGLITSLIATHSLRADTELKNSRTGSVYIVKPKMHGPDEVAFTNELFGRIEDVLGV
PRNTLKVGIMDEERRTTVNLKACIQAAAERVVFINTGFLDRTGDEIHTSMEAGPMVRKAE
MKGQQWIKSYEDWNVDTGLATGLPGKAQIGKGMWAMPDLMADMLVQKIGHPKAGANTAWV
PSPTAATLHATHYHQVNVLDRQQEILKGGPRATVDQILEIPLAAAPNWSAEEKQQELDNN
SQSILGYVVRWIDQGVGCSKVPDIEDVALMEDRATLRISSQLMANWLRHGIVTADEVVAS
LERMAPIVDRQNAGDRNYRPLSPDFAGSIAFQAAKELILEGTKQPNGYTEPILHRRRREA
KAACK
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgacagagcggattcaggtcggcgggcttcaggtggccagcgttctccacgagttcatc
gagaacgaggcgcttcccggaaccggcgtagattccgccgcgttctgggccggtgccgag
gaggtcatcaacgacctcgcgccgcgcaaccgcgcgttgctcgccgaacgcgacgagatc
cagggcaaggtcgacgcctggcacgccgagcaccccggcgcgaactacgacaaggccgcc
tacaagaacttcctgagcgaaatcggctatctgcgccccgagcccgccgatttccagatc
agcacgcagaatgtggacgacgagatcgccaccaccgcgggcccgcagctcgtggtgccg
gtgatgaacgcgcgcttcgcgatcaacgcggccaacgcccgctggggttcgctctacgac
gcgctctacggcaccgacgccatctccgaggccaacggcgcggaaaagggcaagagctac
aacaaggttcgcggcgacaaggtcatcgagtgggcgcgtaacttcctcgacgacgcggcg
accctgatcaccggctcgcacatcggctccacctcgtacaagatcgtcgacggtgagctc
gaggtcggcctcgaggacggcaccgagatcgggctcgccgatccgtcgcagctggtcggt
tacctcggcgattcggacgcgccgacctcggtgctgctgaagcacaacggtctgcacatc
gagatccagatcgatgcggactcgccgatcggcagcaccgacaccgcgggcgtgaaagat
ctggtgctggagtccgcggtcaccacgatcatggacttcgaggactcggtcgccgcggtc
gacgccgaggacaaggtgctctgctaccacaactggctcggcctgatgaagggcgatctc
agcgagcaggtcagcaagggcgaccagaccttcacccgcaccatgaacccggaccgggtc
tacaccgcgctcgacggcggtgagctggtgctgcacggccgttcgctgctgttcgtgcgc
aacgtcggtcacctgatgaccagcgacgccatcctcgacgccgacggcaacgaggtgccc
gagggcatcctcgacggcctgatcacctcgctcatcgcgacgcattcgctgcgcgccgac
accgaactgaaaaacagccgcaccggctcggtctacatcgtgaagccgaagatgcacggc
cccgacgaggtcgcgttcaccaacgagctgttcggccggatcgaagacgtgctcggcgtg
ccgcgcaacaccctcaaggtcggcatcatggacgaggagcgccgcaccacggtgaacctg
aaggcctgtatccaggctgccgccgaacgcgtggtgttcatcaacaccggcttcctcgac
cgcaccggcgacgagatccacacctccatggaggccgggccgatggtccgcaaggccgag
atgaagggccagcagtggatcaagtcctacgaagactggaacgtcgacaccggcctggcc
accggactgcccggtaaggcacagatcggcaagggcatgtgggccatgccggacctgatg
gccgacatgctggtgcagaagatcggccaccccaaggccggcgccaacaccgcgtgggtg
ccctcgcccaccgccgccaccctgcacgcgacccactaccaccaggtcaacgtgctcgac
cggcagcaggaaatcctcaagggcggcccgcgcgccaccgtcgaccagatcctggagatc
ccgctcgccgcggccccgaattggtcggccgaggagaagcagcaggagctggacaacaac
tcccagtcgatcctcggctacgtggtgcgctggatcgaccagggcgtcggctgctccaag
gtgcccgacatcgaagacgtcgcgctcatggaagaccgtgccacccttcgcatttccagc
cagctgatggcgaactggctgcgccacggcattgtcaccgccgacgaggtggtggccagc
ctggaacggatggcgccgatcgtcgaccgccagaacgccggcgaccgcaactaccgcccg
ctgtcgccggacttcgccggcagcatcgccttccaagccgccaaggaactgatcctcgaa
ggcaccaagcagcccaacggctacaccgagccgattctgcaccggcgtcgtcgggaagcc
aaggcggcctgcaagtag

DBGET integrated database retrieval system