KEGG   Nocardia brasiliensis: O3I_020135Help
Entry
O3I_020135        CDS       T02270                                 

Definition
hypothetical protein
Orthology
K16051  
3-oxo-5alpha-steroid 4-dehydrogenase [EC:1.3.99.5]
Organism
nbr  Nocardia brasiliensis
Pathway
Steroid degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    O3I_020135
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.99  With other acceptors
    1.3.99.5  3-oxo-5alpha-steroid 4-dehydrogenase (acceptor)
     O3I_020135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4510142..4511611)
Genome map
AA seq 489 aa AA seqDB search
MTDANALRPLRASAVTEWDLRADVVVAGYGIAGVCAAIEAARAGAEVLILERTGGWGGAA
AMAGGFIYLGGGTPLQQALGFEDTPENMETFLLAALGPGVDQAKIADYCRGSVEHYNWLV
ANGVPFREAFWGEPGWEPPHDEGLMYSGGENAAPFNALAKPAPRGHVPQMADKKIGRKSG
GYMLMKPLAETAESLGVRVEYDLRIGRLVVDDDDRVVGVIARRYGKEVAIRAERGLVLAT
GSFAYHQQMIEGYAPRLIGRPAAAIEEHDGIGIRVAQALGAELAHMDATEVAFFGDPQLL
ARGILVNGRGQRFIAEDTYPGRIGQATLIQQENQAFLVIDETAYEAGLATETSTPFFRQP
PTWAAETVAELEADMGLPELALQATVDCYNLHAASGKDPLLGKKPEWVRPLRGSLAAFDM
RGFTAGFTLGGLRTDLDSRVLHVSGAPIPGLYAAGRCTSGLCAGGYVSGASLGDGSFYGR
RAGLAAAKN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatgccaatgcccttcgccccctgcgcgcgagcgcggtcaccgaatgggacctg
cgggccgacgtcgtcgtcgccggatacggcatcgccggggtctgtgcggcgatcgaggcg
gcgcgcgcgggcgccgaggtgctgatcctggaacggaccggcggctggggcggcgcggcg
gcaatggcgggcggattcatctacctcggcggcggcacccccttgcagcaggcgctcggc
ttcgaggacacgccggagaacatggagaccttcctgctcgcggcgctgggccccggcgtg
gaccaggccaagatcgccgactactgccggggcagcgtcgagcactacaactggctggtg
gccaacggagtgccgttccgcgaagccttctggggcgagcccggctgggaaccgccgcac
gacgaggggctgatgtattccggcggcgagaacgccgcgccgttcaatgccctcgccaaa
cccgcgccacgcgggcatgttccgcagatggcggacaagaagatcggccgcaagagcggc
ggctacatgttgatgaagccgctcgcggagaccgccgaatccctcggcgtccgagtcgaa
tacgacctgcgcatcggccggttggtggtggacgacgacgatcgggtggtcggggtgatc
gcccggcgttacggcaaggaggtggcgatccgcgccgagcgcggactcgtcctcgccacc
ggcagtttcgcctatcaccagcagatgatcgagggctacgcgccgcggctgatcggccga
ccggccgccgcgatcgaggagcacgacggcatcggcatccgggtcgcccaggcgctcggc
gcggagctggcacacatggacgcgaccgaggtggcgttcttcggtgacccgcagttgctc
gcgcgcggcatcctggtcaacggtcgcgggcagcggttcatcgccgaggacacctatccc
ggccggatcgggcaggcgacgctgatccagcaggagaaccaggcgttcctcgtcatcgac
gagacggcctacgaggccggactcgccaccgagacgtctaccccgttcttccgccaaccc
ccgacctgggcggcggagacggtcgcggaactcgaggccgacatgggtctgcccgaactc
gccttgcaggcgacggtcgactgctacaacctgcacgccgcttcgggcaaggacccgctg
ctcgggaagaagccggaatgggtacggccgctacgcggttcgctggccgcgttcgacatg
cggggtttcaccgcgggtttcaccctcggcgggctgcgcaccgacctggattcgcgggtg
ctgcacgtctccggcgcgccgatccccgggctctacgccgcggggcggtgcacctcgggg
ctctgcgcgggcgggtacgtgagcggcgcgtcgctgggtgacggcagtttctacggccgc
agggcgggtctggccgcggccaagaactga

DBGET integrated database retrieval system