KEGG   Nocardia brasiliensis: O3I_020200Help
Entry
O3I_020200        CDS       T02270                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nbr  Nocardia brasiliensis
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    O3I_020200
  Metabolism of other amino acids
   00480 Glutathione metabolism
    O3I_020200
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     O3I_020200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4524066..4524551
Genome map
AA seq 161 aa AA seqDB search
MTLRDVPLQTLNGEATTLAELAGDKVVLLVNVASKCGLTPQYSGLVELQQTYAPRGFTVI
GVPCNQFMGQEPGTAAEIQEFCSTTYGVDFPLLAKADVKGEQQHPLYETLVQTADAEGAA
GEVQWNFEKFLIDRDGKVAGRFRPTVTPDAPALVAGIESLL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactcttcgagacgtaccgttgcagacgctgaacggtgaggcgaccacactggccgaa
ctggccggggacaaggtggtgctgctggtcaacgtggcatccaaatgcgggctgaccccg
cagtattccgggctggtcgagttgcagcagacctatgcgccgcgcggtttcacggtgatc
ggcgtgccgtgtaatcagttcatgggtcaggagcccggtacggccgcggagatccaggaa
ttctgctcgaccacctacggggtcgatttcccgctgctggccaaggccgacgtgaaaggc
gagcagcagcacccgctctacgagacgctggtgcagaccgccgatgccgagggcgcggcg
ggcgaggtgcagtggaacttcgagaagttcctgatcgatcgggacggcaaggtggcgggc
cggttccggccgaccgtcactccggacgctcccgcgctcgtcgcgggcatcgaatccttg
ctctga

DBGET integrated database retrieval system