KEGG   Nocardia brasiliensis: O3I_020300Help
Entry
O3I_020300        CDS       T02270                                 

Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00984  Steroid degradation
nbr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    O3I_020300
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     O3I_020300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C DAO GMC_oxred_N Pyr_redox_2 FAD_binding_2 NAD_binding_8 FAD_binding_3 Fer4_9 Fer4_21 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AFU02019
UniProt: K0EY70
Position
complement(4598021..4599742)
Genome map
AA seq 573 aa AA seqDB search
MDQRTTDFDVLIVGSGFGGSVTALRLVEKGYKVGVLEAGQRFADDELPKTSWELKKFLWA
PKLGCYGIQRIHLLRDVLILGGAGVGGGSLNYANTLYVPPAPFFQDAQWREITDWQAELA
PYYEQAQKMLGVVRNPHMTPADEVFKQVAEDLGVGDTFVQTPVGVFFGEPGKTVTDPYFG
GVGPERTGCIECGDCMVGCKYGAKNTLVKNYLYLAEKAGAQVIPMTTVTDLRPHPDGTWD
VSTARTGAWLRKQPKTYTAANVVLAAGTRGTQKLLFEMQDKGALTELSPRLGQLTRTNSE
SIVGAATKKVTPGVDFTKGVAITSSIHPTPDTHIEPVRYGKGSNAMGLLQTLMVDGGGRI
PRWLRFLGLVLRHPMNLLSFLSTKNWSERTIISLVMQHLDNSITTYTKRGLFGRKMTSKQ
GHGEPNPTWIPMGNNVTRRVAEKIGGIAGGSWGEIFNIPLTAHFLGGAVIGADAEHGVID
GYHRVYGYPTLSVVDGAAVSANLGVNPSLTITAQAERAAAYWPNKGELDIRPPLGAGYRQ
IPPVAPAKPVVPANAPAALVLPIVQIRETPAAG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggaccagcggacgacggatttcgacgtcctcatcgtcggctccggcttcggtggcagc
gtcaccgcactgcggctggtcgagaagggctacaaggtcggcgtactggaggcgggccag
cggttcgccgacgacgaactgcccaagaccagctgggaactgaagaagttcctctgggcg
cccaaactcggctgctacggcatccagcgcatccacctgctgcgcgatgtcctgatcctc
ggcggtgcgggcgtcggcggcggctcgctgaactacgccaatacgctctacgtgccgccg
gcgccgttcttccaggacgcgcagtggcgcgagatcaccgactggcaggccgagctggcg
ccgtactacgagcaggcacagaagatgctcggcgtggtgcgcaacccgcacatgacaccg
gccgacgaggtgttcaaacaggtcgccgaggacctcggggtcggcgacaccttcgtgcag
acgccggtcggcgtgttcttcggtgagcccggaaagaccgtcaccgacccgtatttcggc
ggcgtcggcccggagcgcaccggctgcatcgaatgcggcgactgcatggtgggctgcaag
tacggcgcgaagaacaccctcgtgaagaactacctctacctcgcggaaaaggcaggcgcg
caggtcattccgatgaccacagtgaccgatctgcggccacacccggacggcacctgggac
gtctccaccgcccgcaccggtgcctggctgcgcaagcagcccaagacctacaccgccgcc
aacgtagtactcgccgcgggcacccggggcacccagaagctgctgttcgagatgcaggac
aagggcgcgctcaccgagctgtcgccgcgcctcggccagctgacccgcaccaactccgaa
tcgatcgtcggtgccgcgaccaaaaaggtcacgcccggtgtcgatttcaccaagggcgtg
gcgatcacctcgtccatccatcccacgccggacacccatatcgagccggtccgctacggc
aagggctccaacgccatgggcctgttgcagacgctgatggtggacggcggcggccggatt
ccgcgctggctgcgcttcctgggcctggtgctgcggcatccgatgaacctgctgagcttc
ctgagcaccaagaactggagcgagcggaccatcatctcgctcgtcatgcagcacttggac
aattcgatcaccacctacaccaagcgcgggttgttcggccgcaagatgaccagcaaacag
ggccatggcgaaccgaatccgacgtggattccgatgggcaacaacgtgacccggcgggtg
gccgaaaagatcggcggcatcgcgggcggcagctggggtgagatcttcaatatcccgctc
accgcacacttcctgggcggcgcggtgatcggcgccgacgccgagcacggcgtaatcgac
ggttaccaccgcgtgtacggttacccgaccctgagcgtcgtcgacggcgcggcggtatcg
gcgaacctcggcgtcaatccgtcgctcaccatcaccgcccaggccgaacgcgccgccgcc
tactggccgaacaagggcgagctcgacatcaggccgccgctcggcgccggctaccggcag
atccccccggtcgcccccgccaagccggtcgtgcccgcgaacgcccctgccgcactggta
cttccgatcgtgcagatcagggagacgccggccgcgggctga

DBGET integrated database retrieval system