KEGG   Nocardia brasiliensis: O3I_021250Help
Entry
O3I_021250        CDS       T02270                                 

Definition
putative amidotransferase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
nbr  Nocardia brasiliensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:nbr00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4802029..4803891
Genome map
AA seq 620 aa AA seqDB search
MCGITGWVALDRDLTAEGRTVQAMVDTMAARGPDDEGMWLHPRCALGHRRLSVIDLEGGK
QPMATPETLSDGTPLAVLSYSGEVYNFVELRDELLTLGHRFRTRSDTEVVLRAYLEWGTG
FVRRLNGMFAFAIWDSRTEELLLYRDRLGVKPLFYYPTRDGLLFGSEPKAVLAHPESRAE
LSLDGLRDVLSFVRVPGRTPLQGMYEVRPGHVLRLRGGRRSEEKYWELQSWPHPDDVTTS
VGKVRELLADIVSRQMVADVPLCTLLSGGLDSSALTALGQRALDAGRGGRIRSFSVDFVG
QVENFEPEPLREAPDAPFAAELVRHVGTDHRVILLDNADLASPSARAAVLRAWDLPYGDG
DLGPSLYLLFRAVRQESTVALSGESADEVFGGYLWFHDQRAVQADTFPWHALGERSVADQ
STAFLDPDLTAQLNLTEYIADQYHTALREVPELPGETGLDRRMRAASYLNLTRFLPVMLD
RKDRLSMASGIEVRVPFCDHRLVEYVFNAPWSMKTFDGREKSLLRAATRDLLPDSIVRRR
KAPYPSTQDSGYDKAIKQVLGKIVAEPNSPSLPLLDLDAIHRHLDQPVDKPVSMQERGLL
NETPIRIDEWLTAYDVRVLV
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcaccggctgggtcgcgctcgaccgtgacctcaccgccgaaggccggaca
gtgcaggccatggtcgacaccatggccgctcggggccccgacgacgaaggcatgtggctg
cacccgcgctgcgccctcgggcaccggcggctgtcggtgatcgacctcgaaggcggcaag
cagccgatggccacaccggaaacactgtccgacggaacaccgttggccgtactgagttac
agcggcgaagtgtacaacttcgtcgaactgcgcgacgaactcctgacactcggccaccgc
ttccgcaccagaagcgacaccgaggtcgtgctgcgcgcctatctcgaatggggaacgggc
tttgtgcggcggctcaacggcatgttcgccttcgcgatctgggacagccgaaccgaggaa
ctgctgctgtaccgcgaccggctcggcgtcaaaccgctgttctattaccccacccgcgac
ggcctgctcttcggctccgagccgaaagccgttctcgcccatccggaaagccgcgccgaa
ctatctctcgacggactccgtgacgtgctgtcctttgtccgcgtccccggccggacgccg
ctacaaggcatgtacgaggtgcggcccggccatgtactccggctccgcggcggacggcga
tccgaggagaagtactgggagctgcaatcctggccgcaccccgacgatgtgaccaccagc
gtcggtaaggtgcgagagttgttggcggatatcgtctcccggcagatggtcgccgacgtt
ccgctgtgcacgctactgtccggcgggttggattccagcgcgttgaccgccctgggccag
cgcgcgctcgacgccggccgcggtggccggattcgcagcttctcggtggatttcgtcggt
caggtggagaatttcgaaccggaaccgctgcgcgaggcgccggacgcgccgttcgccgcg
gaactggtccgccacgtcggcaccgatcatcgagtcatcttgctggacaacgcggatctg
gcgtcgccgagcgcacgagcggcggtgttgcgcgcctgggatctgccctacggcgacggt
gatctcggtccgtcgctctatctgctgttccgcgcggtaaggcaggaatcgaccgtcgcc
ctgtccggtgaatcggcggacgaggtgttcggcggctacctctggttccacgatcagcgt
gcggtgcaggccgatacgttcccgtggcacgcgctcggcgagcgctccgtcgccgatcag
tccacggccttcctggatcccgatctgacggcgcagctgaacctcaccgaatacattgcg
gaccaatatcacaccgccctgcgggaagttccggaactgcccggcgagaccggactcgac
cgccggatgcgggccgcgagctacctgaatctcacccggttcctcccggtcatgctcgac
cgcaaggaccggctgagcatggcgagcgggatcgaggtgcgggtaccgttctgcgaccac
cgcctggtcgagtacgtcttcaacgccccgtggtcgatgaagaccttcgacggccgggag
aagagtctgctgcgcgccgcgacccgggatctgctgccggactccatcgtgcgacgccgg
aaagcgccctatccgtccacccaggattcgggctacgacaaggcgatcaagcaggtcctc
ggcaagatcgtcgcggagccgaattcgccgtcgctgccgctgctcgatctcgacgcgatc
caccggcatctggatcagcccgtcgacaagcctgtttcgatgcaggaaagggggctactc
aacgaaacaccgatccgcatcgatgagtggctcaccgcttacgacgtgcgcgtactggta
tag

DBGET integrated database retrieval system