KEGG   Nocardia brasiliensis: O3I_021370Help
Entry
O3I_021370        CDS       T02270                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
nbr  Nocardia brasiliensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nbr01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:nbr00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4863783..4864988)
Genome map
AA seq 401 aa AA seqDB search
MDIAALDAAIDEPELIEFTRDLVRTHSLTEAGRGERAVADFLLTKIREWGWQPEFFDADG
RPNIAVTLSGGGGPGPTLAFEGHMDVVTEGDPGQWTVDPYGGEIRDGKLYGRGSADMKSG
VAAMLYGTRALQLTGPFPGRIRLLLLADEEGMMSGAKAAVAQGFVRDVDGVVCCEPEGDE
VCPVSKGAIRLRVDFTGVMSHGAMPWQGRNTLPAMARAVLGLEALEHRLVQEAGSRPPLG
APSITPTVVRAGTADQLNTISGVSSMFLDVRTIPGVDHETLLKNIGECVDNAARGCGIGS
AVTVIDDRPWISTDPDAPLVTALVRAHEIVNGVRPELGAVPGTTDGTILTCRANIPSVVY
GPGGKWIAHMADEYVEVRDLKRYALTYAVAAQDFLRGGAVS
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
gtggacatcgccgcactggatgccgcaatcgacgagccggaactcatcgaattcacccgc
gacctggttcgcacccactcgttgaccgaggcgggccgtggggagcgcgcagtcgcggac
ttcctgctcaccaagatcagggaatggggttggcagcccgagttcttcgacgcggacggc
cgccccaatatcgcggtcacactgtccggcggcggcggtcccgggccgaccttggccttc
gagggacatatggatgtggtcaccgagggcgatccgggccagtggaccgtcgatccctac
ggcggcgagatccgcgacggcaagctctacggtcgcggctcggccgatatgaagtccgga
gtcgccgcgatgctgtacgggacaagggcattgcagctgaccgggccgtttcccggccgg
atccgcctgctcctgctcgccgacgaggaagggatgatgtcgggggcgaaagccgctgtg
gcccaagggttcgtccgggatgtcgacggcgtcgtgtgctgtgagccggagggcgacgag
gtgtgcccggtgtcgaaaggcgcgatccggctccgggtggatttcaccggggtgatgagc
cacggcgcgatgccgtggcagggccggaacacgttgcccgccatggcccgtgcggtgctc
ggcctggaagcgctggagcaccggctggtgcaggaggcggggtcgcgaccgccgctcggc
gcaccgtcgatcacgcccaccgtggtgcgcgccgggaccgccgatcagctcaacacgatt
tccggcgtgagctcgatgttcctcgatgtgcgcacgataccgggcgtggatcacgagacg
ctgctgaagaacatcggcgagtgcgtcgacaacgcggcgcgcggctgcggcatcggttcg
gccgtcacggtgatcgacgatcgcccctggatctcgacggacccggacgcaccgctggtc
acggcgctggtccgcgcgcacgagatcgtgaacggggtccgtccggaactcggcgcggtg
cccggcaccaccgacggcaccattctgacctgtcgcgcgaacatcccgagcgtggtgtac
ggcccgggcggcaagtggatcgcgcacatggccgacgaatacgtcgaggtgcgcgacctc
aagcgctacgccctgacgtatgcggttgcggcacaagacttcctgcgcggcggcgcggta
tcgtga

DBGET integrated database retrieval system