KEGG   Nocardia brasiliensis: O3I_022420Help
Entry
O3I_022420        CDS       T02270                                 

Definition
amine oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
nbr  Nocardia brasiliensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3I_022420
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     O3I_022420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5080030..5081352)
Genome map
AA seq 440 aa AA seqDB search
MAPQQQSTTNRYAVVGAGIAGLAAAHRLRRAGHDVELIERDAVLGGRMGLDRLGTRPIMV
GGKNLGRKYSELRAFLTDLGDPALEPFGINTSRVVHGRLLTFDSTASPLRRLRVLLDGGS
IADLVKLFRLAVQVRRKEENRFLGSADFTEIAERSDERPLSAHFGPRAVRNILRAMTVRM
NGAEPDEVYLGTFGTNLGMLMDTFDQLTDGMDPVIAALAEQISVSTRTVAVGLVLSDGGV
GCLRVTQDGGPPQEQYYDGVVVALPAPAAAQLLASEMPTLSKQLAQVAYFPAAVAVVEYD
EPVFGMTTRAIALDDGPCSNAGVYGTDDLHIVRYTFSGRAARSSTTGEVDEWLDQAEARI
AGLLGRTRMTRVRTVVRQWEAAYCAYLPFHGSFLRQVRTETAAVPGLELAGDYLRGAPLE
AAFRSGVEAADRLLASAHGQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcaacagcagtcgaccacgaaccgatacgcggtcgtcggcgccggaatcgcc
gggctcgccgccgcgcatcgactgcggcgagccggacatgacgtcgagctgatcgaacgt
gacgcggtgctcggtggccgcatgggcctggatcggctcgggacgcgaccgatcatggtg
ggcggtaagaacctgggccgcaagtattccgagctgcgggccttcctgaccgacctgggc
gacccggcgctggaaccgttcggcatcaacacctcgcgggtcgtgcacgggcgactgctg
accttcgacagcaccgcgagcccgctgcgcaggctgcgcgtgctgctggacggtggctcg
atcgccgacttggtgaagttgttccggctcgccgtgcaggtccggcggaaggaggagaac
agatttctcggctccgcggatttcaccgagatcgccgagcgcagcgacgagcgcccgctg
agtgcccacttcggtccgcgggcggtgcgtaacatattgcgcgccatgacggttcggatg
aacggggccgagccggacgaggtctatctcggcactttcgggacgaacctcgggatgctc
atggacaccttcgatcagctcaccgacggcatggacccggtcatcgcggccttggcggaa
cagatctcggtctcgacccgcacggtggcagtgggcctcgtcctgagcgacggcggcgta
ggctgcctgcgggtcacgcaggacggtgggccgccgcaggagcaatactatgacggtgtg
gtcgtggcactgcccgcgcctgccgccgctcagctgttggcgagcgagatgcccacgctg
agcaagcaactcgcccaggtcgcctatttcccggccgcggtggcggtcgtcgaatacgac
gagccggtgttcgggatgacgacccgtgccatcgcactcgacgacggaccgtgcagcaac
gccggtgtttacgggaccgacgatctgcacatcgtccggtacaccttcagcggccgggcg
gcgcgttcgtccacgacgggcgaggtggacgagtggctcgaccaggcggaagcgcggatc
gcgggcctgctcggccggacccggatgacgcgggtgcgcaccgtcgtccggcagtgggag
gccgcctactgtgcgtacttgccgttccacggcagcttcctgaggcaggtgcgcaccgag
acggccgcggtgcccggactcgaactggccggtgactatctgcgcggcgcgccgctggag
gcggcgttccgctccggtgtcgaagcggcggaccgactgctcgcgtcggcgcacggtcag
tag

DBGET integrated database retrieval system