KEGG   Nocardia brasiliensis: O3I_022420Help
Entry
O3I_022420        CDS       T02270                                 

Definition
(GenBank) amine oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
nbr  Nocardia brasiliensis
Pathway
nbr00860  Porphyrin and chlorophyll metabolism
nbr01100  Metabolic pathways
nbr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nbr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    O3I_022420
Enzymes [BR:nbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     O3I_022420
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     O3I_022420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_2 FAD_binding_2 FAD_oxidored DAO GIDA Pyr_redox FAD_binding_3 ApbA HI0933_like MotA_ExbB Thi4 AlaDh_PNT_C Pyr_redox_3 Lycopene_cycl Trp_halogenase Flg_hook 3HCDH_N NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: AFU02439
UniProt: K0EZB1
Position
complement(5080030..5081352)
Genome map
AA seq 440 aa AA seqDB search
MAPQQQSTTNRYAVVGAGIAGLAAAHRLRRAGHDVELIERDAVLGGRMGLDRLGTRPIMV
GGKNLGRKYSELRAFLTDLGDPALEPFGINTSRVVHGRLLTFDSTASPLRRLRVLLDGGS
IADLVKLFRLAVQVRRKEENRFLGSADFTEIAERSDERPLSAHFGPRAVRNILRAMTVRM
NGAEPDEVYLGTFGTNLGMLMDTFDQLTDGMDPVIAALAEQISVSTRTVAVGLVLSDGGV
GCLRVTQDGGPPQEQYYDGVVVALPAPAAAQLLASEMPTLSKQLAQVAYFPAAVAVVEYD
EPVFGMTTRAIALDDGPCSNAGVYGTDDLHIVRYTFSGRAARSSTTGEVDEWLDQAEARI
AGLLGRTRMTRVRTVVRQWEAAYCAYLPFHGSFLRQVRTETAAVPGLELAGDYLRGAPLE
AAFRSGVEAADRLLASAHGQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgcaacagcagtcgaccacgaaccgatacgcggtcgtcggcgccggaatcgcc
gggctcgccgccgcgcatcgactgcggcgagccggacatgacgtcgagctgatcgaacgt
gacgcggtgctcggtggccgcatgggcctggatcggctcgggacgcgaccgatcatggtg
ggcggtaagaacctgggccgcaagtattccgagctgcgggccttcctgaccgacctgggc
gacccggcgctggaaccgttcggcatcaacacctcgcgggtcgtgcacgggcgactgctg
accttcgacagcaccgcgagcccgctgcgcaggctgcgcgtgctgctggacggtggctcg
atcgccgacttggtgaagttgttccggctcgccgtgcaggtccggcggaaggaggagaac
agatttctcggctccgcggatttcaccgagatcgccgagcgcagcgacgagcgcccgctg
agtgcccacttcggtccgcgggcggtgcgtaacatattgcgcgccatgacggttcggatg
aacggggccgagccggacgaggtctatctcggcactttcgggacgaacctcgggatgctc
atggacaccttcgatcagctcaccgacggcatggacccggtcatcgcggccttggcggaa
cagatctcggtctcgacccgcacggtggcagtgggcctcgtcctgagcgacggcggcgta
ggctgcctgcgggtcacgcaggacggtgggccgccgcaggagcaatactatgacggtgtg
gtcgtggcactgcccgcgcctgccgccgctcagctgttggcgagcgagatgcccacgctg
agcaagcaactcgcccaggtcgcctatttcccggccgcggtggcggtcgtcgaatacgac
gagccggtgttcgggatgacgacccgtgccatcgcactcgacgacggaccgtgcagcaac
gccggtgtttacgggaccgacgatctgcacatcgtccggtacaccttcagcggccgggcg
gcgcgttcgtccacgacgggcgaggtggacgagtggctcgaccaggcggaagcgcggatc
gcgggcctgctcggccggacccggatgacgcgggtgcgcaccgtcgtccggcagtgggag
gccgcctactgtgcgtacttgccgttccacggcagcttcctgaggcaggtgcgcaccgag
acggccgcggtgcccggactcgaactggccggtgactatctgcgcggcgcgccgctggag
gcggcgttccgctccggtgtcgaagcggcggaccgactgctcgcgtcggcgcacggtcag
tag

DBGET integrated database retrieval system